BLASTX nr result
ID: Coptis23_contig00016469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016469 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306011.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 >ref|XP_002306011.1| predicted protein [Populus trichocarpa] gi|222848975|gb|EEE86522.1| predicted protein [Populus trichocarpa] Length = 462 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = -2 Query: 156 GCKPNCIYFTDHFWSYFNEQG-FGGHDYGIFNLEEASIEKLLYPSDTLMIMPP 1 GC+ N +YFTD +W NE +GGHD G+FNL++ S+ K Y D L I PP Sbjct: 402 GCEKNSVYFTDDYWERMNEDYLYGGHDMGVFNLKDKSV-KHFYQLDALKIQPP 453