BLASTX nr result
ID: Coptis23_contig00016303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016303 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271147.1| PREDICTED: nodal modulator 1 [Vitis vinifera... 60 2e-07 >ref|XP_002271147.1| PREDICTED: nodal modulator 1 [Vitis vinifera] gi|297743995|emb|CBI36965.3| unnamed protein product [Vitis vinifera] Length = 1199 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/40 (72%), Positives = 36/40 (90%), Gaps = 2/40 (5%) Frame = -3 Query: 366 FISMPRLKDLYQSTV--ASSGSTSTLKKEMRRPIMRKKTY 253 FISMPRLKDLYQ+T+ + SG+TST KKE+R+PI+RKKTY Sbjct: 1160 FISMPRLKDLYQTTMGMSMSGATSTAKKEVRKPILRKKTY 1199