BLASTX nr result
ID: Coptis23_contig00015996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00015996 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529174.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002529174.1| conserved hypothetical protein [Ricinus communis] gi|223531352|gb|EEF33188.1| conserved hypothetical protein [Ricinus communis] Length = 176 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 264 GGLEDMLLHALYLNNEGTRVEVLEFFGKMHSEDYLDCEATLQNYFDWKPM 115 G LE+ LLH + G +VEV +F GK H+EDYLD ++ +NYF+WKPM Sbjct: 21 GRLEERLLHT---HGGGVKVEVADFHGKSHTEDYLDWKSNSENYFEWKPM 67