BLASTX nr result
ID: Coptis23_contig00015831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00015831 (864 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276359.2| PREDICTED: anoctamin-7-like [Vitis vinifera]... 75 1e-11 ref|XP_002515888.1| conserved hypothetical protein [Ricinus comm... 72 1e-10 ref|XP_002458377.1| hypothetical protein SORBIDRAFT_03g032470 [S... 72 2e-10 tpg|DAA57935.1| TPA: hypothetical protein ZEAMMB73_655303 [Zea m... 71 4e-10 ref|NP_001168598.1| uncharacterized protein LOC100382382 [Zea ma... 71 4e-10 >ref|XP_002276359.2| PREDICTED: anoctamin-7-like [Vitis vinifera] gi|297743119|emb|CBI35986.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 707 VG*GLQFEWDEVEAFVRQPDGSLFSWCERFCCFTHLLYGI 826 +G LQFEWDEVEAFVRQPDGSLFSW ERF CF HL+YGI Sbjct: 81 IGMDLQFEWDEVEAFVRQPDGSLFSWWERFRCFNHLIYGI 120 >ref|XP_002515888.1| conserved hypothetical protein [Ricinus communis] gi|223544793|gb|EEF46308.1| conserved hypothetical protein [Ricinus communis] Length = 655 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 707 VG*GLQFEWDEVEAFVRQPDGSLFSWCERFCCFTHLLYGI 826 +G LQFEW+E++ FVRQPDGSLFSWCERF C+ HLLYGI Sbjct: 85 IGMDLQFEWEELKVFVRQPDGSLFSWCERFECYGHLLYGI 124 >ref|XP_002458377.1| hypothetical protein SORBIDRAFT_03g032470 [Sorghum bicolor] gi|241930352|gb|EES03497.1| hypothetical protein SORBIDRAFT_03g032470 [Sorghum bicolor] Length = 657 Score = 72.0 bits (175), Expect = 2e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 707 VG*GLQFEWDEVEAFVRQPDGSLFSWCERFCCFTHLLYGI 826 +G LQFEWD+V AFVRQPDGSLFSW ER+CCF +L+YGI Sbjct: 87 IGMELQFEWDQVAAFVRQPDGSLFSWRERYCCFRYLIYGI 126 >tpg|DAA57935.1| TPA: hypothetical protein ZEAMMB73_655303 [Zea mays] Length = 574 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +2 Query: 707 VG*GLQFEWDEVEAFVRQPDGSLFSWCERFCCFTHLLYGI 826 +G LQF+WD+V AFVRQPDGSLFSW ER+CCF +L+YGI Sbjct: 86 IGMELQFQWDQVAAFVRQPDGSLFSWRERYCCFRYLIYGI 125 >ref|NP_001168598.1| uncharacterized protein LOC100382382 [Zea mays] gi|223949439|gb|ACN28803.1| unknown [Zea mays] gi|414880805|tpg|DAA57936.1| TPA: starch branching enzyme interacting protein-1 [Zea mays] Length = 656 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +2 Query: 707 VG*GLQFEWDEVEAFVRQPDGSLFSWCERFCCFTHLLYGI 826 +G LQF+WD+V AFVRQPDGSLFSW ER+CCF +L+YGI Sbjct: 86 IGMELQFQWDQVAAFVRQPDGSLFSWRERYCCFRYLIYGI 125