BLASTX nr result
ID: Coptis23_contig00015256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00015256 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282645.1| PREDICTED: B3 domain-containing protein Os06... 59 5e-07 emb|CBI19534.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_004152735.1| PREDICTED: B3 domain-containing protein At5g... 54 1e-05 >ref|XP_002282645.1| PREDICTED: B3 domain-containing protein Os06g0194400-like [Vitis vinifera] Length = 252 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/60 (46%), Positives = 47/60 (78%), Gaps = 3/60 (5%) Frame = +2 Query: 110 VVSVRIETSTREQAS--LNPDKVKSCA-EKAEKFKANLEPEFPSFVKAMLRSHVSGGYWL 280 VVS RI + R+ ++ ++ ++CA E+AE+ +A+LEP++PSF+K+ML+SHV+GG+WL Sbjct: 85 VVSERIHSKGRDLSNRVYASEEARTCAMERAEELQASLEPQYPSFLKSMLQSHVTGGFWL 144 >emb|CBI19534.3| unnamed protein product [Vitis vinifera] Length = 217 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/52 (50%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +2 Query: 128 ETSTREQASLNPDKVKSCA-EKAEKFKANLEPEFPSFVKAMLRSHVSGGYWL 280 + S R AS ++ ++CA E+AE+ +A+LEP++PSF+K+ML+SHV+GG+WL Sbjct: 80 DLSNRVYAS---EEARTCAMERAEELQASLEPQYPSFLKSMLQSHVTGGFWL 128 >ref|XP_004152735.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis sativus] gi|449495997|ref|XP_004160007.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis sativus] Length = 229 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/62 (41%), Positives = 42/62 (67%), Gaps = 3/62 (4%) Frame = +2 Query: 104 NKVVSVRIETSTREQAS---LNPDKVKSCAEKAEKFKANLEPEFPSFVKAMLRSHVSGGY 274 N+VV R + R+ ++ + + K E+AE+ ++ LEP +PSF+K+ML+SHVSGG+ Sbjct: 81 NRVVIPRRISKARDLSNRVYASDEARKEAFERAEQLQSGLEPNYPSFIKSMLQSHVSGGF 140 Query: 275 WL 280 WL Sbjct: 141 WL 142