BLASTX nr result
ID: Coptis23_contig00015246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00015246 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530504.1| proliferation-associated 2g4, putative [Rici... 100 2e-19 ref|NP_001242070.1| uncharacterized protein LOC100784176 [Glycin... 100 2e-19 ref|XP_003516956.1| PREDICTED: proliferation-associated protein ... 99 3e-19 gb|ABF66654.1| EBP1 [Ammopiptanthus mongolicus] gi|146336945|gb|... 99 3e-19 ref|XP_002278744.2| PREDICTED: proliferation-associated protein ... 99 4e-19 >ref|XP_002530504.1| proliferation-associated 2g4, putative [Ricinus communis] gi|223529961|gb|EEF31888.1| proliferation-associated 2g4, putative [Ricinus communis] Length = 394 Score = 100 bits (248), Expect = 2e-19 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +3 Query: 42 MSDDEANEEKELDLTSPEVVTKYKTAADIVNKALQLVLSECKPKAKIVYLCEKGDVYIR 218 MSDDE EEKELDLTSPEVVTKYK+AA+IVNKALQLV+SECKPKAKIV LCEKGD +IR Sbjct: 1 MSDDE-REEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDAFIR 58 >ref|NP_001242070.1| uncharacterized protein LOC100784176 [Glycine max] gi|255645274|gb|ACU23134.1| unknown [Glycine max] Length = 390 Score = 99.8 bits (247), Expect = 2e-19 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +3 Query: 42 MSDDEANEEKELDLTSPEVVTKYKTAADIVNKALQLVLSECKPKAKIVYLCEKGDVYIR 218 MSDDE EEKELDLTSPEVVTKYK+AA+IVN+ALQLV+SECKPKAKIV LCEKGD YIR Sbjct: 1 MSDDE-REEKELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIR 58 >ref|XP_003516956.1| PREDICTED: proliferation-associated protein 2G4-like [Glycine max] Length = 390 Score = 99.4 bits (246), Expect = 3e-19 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = +3 Query: 42 MSDDEANEEKELDLTSPEVVTKYKTAADIVNKALQLVLSECKPKAKIVYLCEKGDVYIR 218 MSDDE EEKELDLTSPEVVTKYK+AA+IVNKALQLV+SECKPK KIV LCEKGD YIR Sbjct: 1 MSDDE-REEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIR 58 >gb|ABF66654.1| EBP1 [Ammopiptanthus mongolicus] gi|146336945|gb|ABQ23586.1| EBP1 [Ammopiptanthus mongolicus] Length = 395 Score = 99.4 bits (246), Expect = 3e-19 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +3 Query: 42 MSDDEANEEKELDLTSPEVVTKYKTAADIVNKALQLVLSECKPKAKIVYLCEKGDVYIR 218 MSDDE EEKELDL+SPEVVTKYKTAA+IVNKAL+LV+SECKPKAKIV LCEKGD YIR Sbjct: 1 MSDDE-REEKELDLSSPEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIR 58 >ref|XP_002278744.2| PREDICTED: proliferation-associated protein 2G4-like [Vitis vinifera] gi|297745872|emb|CBI15928.3| unnamed protein product [Vitis vinifera] Length = 391 Score = 99.0 bits (245), Expect = 4e-19 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +3 Query: 42 MSDDEANEEKELDLTSPEVVTKYKTAADIVNKALQLVLSECKPKAKIVYLCEKGDVYIR 218 MSDDE EE+ELDLTSPEVVTKYKTAA+IVNKALQ+VLSECKPKAKIV +CEKGD +IR Sbjct: 1 MSDDE-REERELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIR 58