BLASTX nr result
ID: Coptis23_contig00015066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00015066 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298835.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 ref|XP_002274947.2| PREDICTED: uncharacterized protein LOC100253... 65 7e-09 ref|XP_002523203.1| protein phosphatases pp1 regulatory subunit,... 64 1e-08 emb|CAN78013.1| hypothetical protein VITISV_039427 [Vitis vinifera] 64 1e-08 ref|XP_004158689.1| PREDICTED: uncharacterized LOC101209660 [Cuc... 62 4e-08 >ref|XP_002298835.1| predicted protein [Populus trichocarpa] gi|222846093|gb|EEE83640.1| predicted protein [Populus trichocarpa] Length = 139 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 74 SSNFLSVSGDYIEGEKLIAPYGYIGGHEGNCLYNWYIHK 190 S NFLS+SGDYIEG L A YGY+GGHEG YNWY+H+ Sbjct: 101 SLNFLSISGDYIEGGLLTASYGYVGGHEGKSEYNWYLHE 139 >ref|XP_002274947.2| PREDICTED: uncharacterized protein LOC100253161 [Vitis vinifera] gi|297740810|emb|CBI30992.3| unnamed protein product [Vitis vinifera] Length = 1717 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 74 SSNFLSVSGDYIEGEKLIAPYGYIGGHEGNCLYNWYIHKV 193 S NFLS++GDYIE L A YGYIGGHEG +YNWY+H+V Sbjct: 898 SLNFLSITGDYIEDGILTASYGYIGGHEGKSIYNWYLHEV 937 >ref|XP_002523203.1| protein phosphatases pp1 regulatory subunit, putative [Ricinus communis] gi|223537610|gb|EEF39234.1| protein phosphatases pp1 regulatory subunit, putative [Ricinus communis] Length = 1582 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +2 Query: 74 SSNFLSVSGDYIEGEKLIAPYGYIGGHEGNCLYNWYIHK 190 S NFLS++GDY EG L A YGYIGGHEG +YNWY+H+ Sbjct: 763 SLNFLSITGDYTEGGMLTASYGYIGGHEGKSVYNWYLHE 801 >emb|CAN78013.1| hypothetical protein VITISV_039427 [Vitis vinifera] Length = 947 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 74 SSNFLSVSGDYIEGEKLIAPYGYIGGHEGNCLYNWYIHKVIYLL 205 S NFLS++GDYIE L A YGYIGGHEG +YNWY+H+ + L+ Sbjct: 437 SLNFLSITGDYIEDGILTASYGYIGGHEGKSIYNWYLHEEVDLV 480 >ref|XP_004158689.1| PREDICTED: uncharacterized LOC101209660 [Cucumis sativus] Length = 1209 Score = 62.4 bits (150), Expect = 4e-08 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 74 SSNFLSVSGDYIEGEKLIAPYGYIGGHEGNCLYNWYIHKV 193 S NFLS++GDY EG L A YGY+GGHEG +Y WY+H++ Sbjct: 920 SLNFLSITGDYTEGGILTASYGYVGGHEGKSIYRWYLHEI 959