BLASTX nr result
ID: Coptis23_contig00014869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00014869 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537925.1| PREDICTED: uncharacterized protein LOC100820... 60 2e-07 ref|XP_003546796.1| PREDICTED: uncharacterized protein LOC100788... 59 5e-07 ref|XP_003543576.1| PREDICTED: uncharacterized protein LOC100775... 59 5e-07 gb|ACU19041.1| unknown [Glycine max] 59 5e-07 ref|XP_002524578.1| nucleic acid binding protein, putative [Rici... 59 5e-07 >ref|XP_003537925.1| PREDICTED: uncharacterized protein LOC100820349 [Glycine max] Length = 280 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 136 KPWEGARASSGPGPFKPPTPGSTSDVVEASGTA 234 KPWE A +SSGP PFKPP+ GSTSDVVEASGTA Sbjct: 10 KPWEKAASSSGPAPFKPPSAGSTSDVVEASGTA 42 >ref|XP_003546796.1| PREDICTED: uncharacterized protein LOC100788885 [Glycine max] Length = 297 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 136 KPWEGARASSGPGPFKPPTPGSTSDVVEASGTA 234 KPWE A +SSGP PFKPP+ G+TSDVVEASGTA Sbjct: 15 KPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTA 47 >ref|XP_003543576.1| PREDICTED: uncharacterized protein LOC100775500 [Glycine max] Length = 301 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 136 KPWEGARASSGPGPFKPPTPGSTSDVVEASGTA 234 KPWE A +SSGP PFKPP+ G+TSDVVEASGTA Sbjct: 15 KPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTA 47 >gb|ACU19041.1| unknown [Glycine max] Length = 301 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 136 KPWEGARASSGPGPFKPPTPGSTSDVVEASGTA 234 KPWE A +SSGP PFKPP+ G+TSDVVEASGTA Sbjct: 15 KPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTA 47 >ref|XP_002524578.1| nucleic acid binding protein, putative [Ricinus communis] gi|223536131|gb|EEF37786.1| nucleic acid binding protein, putative [Ricinus communis] Length = 313 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = +1 Query: 136 KPWE-GARASSGPGPFKPPTPGSTSDVVEASGTA 234 KPWE +SSGP PFKPPTPGSTSDVVEASGTA Sbjct: 29 KPWERSGTSSSGPTPFKPPTPGSTSDVVEASGTA 62