BLASTX nr result
ID: Coptis23_contig00014858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00014858 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002618001.1| hypothetical protein CLUG_01460 [Clavispora ... 55 8e-06 >ref|XP_002618001.1| hypothetical protein CLUG_01460 [Clavispora lusitaniae ATCC 42720] gi|238847873|gb|EEQ37337.1| hypothetical protein CLUG_01460 [Clavispora lusitaniae ATCC 42720] Length = 303 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/60 (46%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = +3 Query: 162 MGK-PVCYVVLEGKNRRVYTNWDDCKAQVNGHSNADYYGCKSVEEAEHRLATHLQRKMSS 338 MGK P Y V G+N VY +WDDCK+QV+G SNA Y S EEA +++ + SS Sbjct: 1 MGKTPYYYAVANGRNAGVYRSWDDCKSQVSGFSNAKYKKFSSAEEASRFVSSGSSKSSSS 60