BLASTX nr result
ID: Coptis23_contig00014787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00014787 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ11748.1| major latex-like protein [Gossypium hirsutum] 55 6e-06 >gb|ACJ11748.1| major latex-like protein [Gossypium hirsutum] Length = 153 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +1 Query: 1 VPKEEGSLVKWGLEYEKASEEVPEPYHIKQTATKAFNCLDAYL 129 VPK E SLVKW E+EKASEE+P+P IK+ A K F +D YL Sbjct: 107 VPKGESSLVKWSCEFEKASEEIPDPSVIKEFAVKNFKEIDDYL 149