BLASTX nr result
ID: Coptis23_contig00014607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00014607 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551662.1| PREDICTED: uncharacterized protein LOC100782... 55 8e-06 >ref|XP_003551662.1| PREDICTED: uncharacterized protein LOC100782204 [Glycine max] Length = 929 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = +2 Query: 5 ISIFDFRQGRSTHKLLSDRRHGSSRHPVGTAPSKSRLKLLNKTDEKDQGS 154 ISIFDFR R T KL++DRRHG S+H VG A +K++ ++L+ DE+ +G+ Sbjct: 24 ISIFDFRHARFTRKLIADRRHG-SKHAVGAALTKNKFEVLSNLDEEYEGN 72