BLASTX nr result
ID: Coptis23_contig00013832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00013832 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284129.1| PREDICTED: activating signal cointegrator 1 ... 85 5e-15 ref|XP_002514664.1| activating signal cointegrator 1 complex sub... 85 7e-15 ref|XP_002328672.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 ref|NP_200922.2| U5 small nuclear ribonucleoprotein helicase [Ar... 82 6e-14 ref|NP_001190584.1| U5 small nuclear ribonucleoprotein helicase ... 82 6e-14 >ref|XP_002284129.1| PREDICTED: activating signal cointegrator 1 complex subunit 3 [Vitis vinifera] gi|297733882|emb|CBI15129.3| unnamed protein product [Vitis vinifera] Length = 2093 Score = 85.1 bits (209), Expect = 5e-15 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = -3 Query: 192 DQVVDSLKQG*QAMVFVHSCKDTGKIAKTLIEYARNMDELALFKDETHPQFALINKDVHK 13 ++VVDSL+QG QAMVFVHS KDT K A+ LIE AR D++ LFK+ETHPQF+L+ +V K Sbjct: 669 NKVVDSLRQGHQAMVFVHSRKDTAKTAEKLIELARRNDDVELFKNETHPQFSLVKMEVMK 728 Query: 12 SRNK 1 SRNK Sbjct: 729 SRNK 732 >ref|XP_002514664.1| activating signal cointegrator 1 complex subunit 3, helc1, putative [Ricinus communis] gi|223546268|gb|EEF47770.1| activating signal cointegrator 1 complex subunit 3, helc1, putative [Ricinus communis] Length = 2100 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = -3 Query: 189 QVVDSLKQG*QAMVFVHSCKDTGKIAKTLIEYARNMDELALFKDETHPQFALINKDVHKS 10 +VVDSL+QG Q MVFVHS KDT K A L+E ARN D+L LFK++ HPQF+L+ K+V KS Sbjct: 674 KVVDSLRQGHQVMVFVHSRKDTAKTADKLVELARNYDDLELFKNDAHPQFSLVKKEVVKS 733 Query: 9 RNK 1 RNK Sbjct: 734 RNK 736 >ref|XP_002328672.1| predicted protein [Populus trichocarpa] gi|222838848|gb|EEE77199.1| predicted protein [Populus trichocarpa] Length = 1544 Score = 84.0 bits (206), Expect = 1e-14 Identities = 41/63 (65%), Positives = 51/63 (80%) Frame = -3 Query: 189 QVVDSLKQG*QAMVFVHSCKDTGKIAKTLIEYARNMDELALFKDETHPQFALINKDVHKS 10 +VVDSLKQG QAMVFVHS KDT K A+ L+E ARN +++ LF+++ HPQFAL K+V KS Sbjct: 281 KVVDSLKQGHQAMVFVHSRKDTAKTAEKLVELARNNEDVELFRNDEHPQFALFKKEVMKS 340 Query: 9 RNK 1 RNK Sbjct: 341 RNK 343 >ref|NP_200922.2| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] gi|332010042|gb|AED97425.1| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] Length = 2146 Score = 81.6 bits (200), Expect = 6e-14 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = -3 Query: 189 QVVDSLKQG*QAMVFVHSCKDTGKIAKTLIEYARNMDELALFKDETHPQFALINKDVHKS 10 +VVDS+KQG QAM+FVHS KDT K A+ L++ AR + L LF +ETHPQF L+ KDV KS Sbjct: 737 KVVDSIKQGHQAMIFVHSRKDTSKTAEKLVDLARQYETLDLFTNETHPQFQLMKKDVMKS 796 Query: 9 RNK 1 RNK Sbjct: 797 RNK 799 >ref|NP_001190584.1| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] gi|9759460|dbj|BAB10376.1| RNA helicase [Arabidopsis thaliana] gi|332010043|gb|AED97426.1| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] Length = 2157 Score = 81.6 bits (200), Expect = 6e-14 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = -3 Query: 189 QVVDSLKQG*QAMVFVHSCKDTGKIAKTLIEYARNMDELALFKDETHPQFALINKDVHKS 10 +VVDS+KQG QAM+FVHS KDT K A+ L++ AR + L LF +ETHPQF L+ KDV KS Sbjct: 737 KVVDSIKQGHQAMIFVHSRKDTSKTAEKLVDLARQYETLDLFTNETHPQFQLMKKDVMKS 796 Query: 9 RNK 1 RNK Sbjct: 797 RNK 799