BLASTX nr result
ID: Coptis23_contig00013831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00013831 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595329.1| Transmembrane protein 184C [Medicago truncat... 65 6e-09 ref|XP_002516252.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 >ref|XP_003595329.1| Transmembrane protein 184C [Medicago truncatula] gi|355484377|gb|AES65580.1| Transmembrane protein 184C [Medicago truncatula] Length = 439 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +1 Query: 1 WWQGVGIALLCAIHVLPNEGKFQIGLQDFLICTEFII 111 WWQGVGIALLC VLPN+GK Q GLQDFLIC E I Sbjct: 262 WWQGVGIALLCTFRVLPNDGKLQTGLQDFLICIEMAI 298 >ref|XP_002516252.1| conserved hypothetical protein [Ricinus communis] gi|223544738|gb|EEF46254.1| conserved hypothetical protein [Ricinus communis] Length = 418 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 1 WWQGVGIALLCAIHVLPNEGKFQIGLQDFLICTEFII 111 WWQGV IALLCA +LPNEGKF+ GLQDFLIC E I Sbjct: 247 WWQGVDIALLCASDILPNEGKFRTGLQDFLICIEMAI 283