BLASTX nr result
ID: Coptis23_contig00013512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00013512 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269300.1| PREDICTED: light-regulated protein [Vitis vi... 74 9e-12 gb|AAX92704.1| light regulated protein Lir1 [Picea abies] 73 3e-11 gb|ABK21366.1| unknown [Picea sitchensis] gi|148908601|gb|ABR174... 73 3e-11 ref|XP_004170126.1| PREDICTED: LOW QUALITY PROTEIN: light-regula... 72 4e-11 gb|ADN33702.1| cytokinin-repressed protein CR9 [Cucumis melo sub... 72 4e-11 >ref|XP_002269300.1| PREDICTED: light-regulated protein [Vitis vinifera] gi|296088179|emb|CBI35671.3| unnamed protein product [Vitis vinifera] Length = 139 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 232 VDREYLEYEDQKTVFPGEACDDLGGEFCQPEYQKGVY 122 VDREYLEY KTVFPGEACDDLGGEFC+PEYQ+GV+ Sbjct: 100 VDREYLEYNSPKTVFPGEACDDLGGEFCEPEYQEGVF 136 >gb|AAX92704.1| light regulated protein Lir1 [Picea abies] Length = 117 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/42 (73%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -2 Query: 232 VDREYLEY-EDQKTVFPGEACDDLGGEFCQPEYQKGVY*KRD 110 +DREY+EY +QKTVFPGEACDDLGGEFC+PEYQ GVY +++ Sbjct: 73 IDREYVEYASEQKTVFPGEACDDLGGEFCEPEYQSGVYKEKE 114 >gb|ABK21366.1| unknown [Picea sitchensis] gi|148908601|gb|ABR17410.1| unknown [Picea sitchensis] Length = 143 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/42 (73%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -2 Query: 232 VDREYLEY-EDQKTVFPGEACDDLGGEFCQPEYQKGVY*KRD 110 +DREY+EY +QKTVFPGEACDDLGGEFC+PEYQ GVY +++ Sbjct: 99 IDREYVEYASEQKTVFPGEACDDLGGEFCEPEYQSGVYKEKE 140 >ref|XP_004170126.1| PREDICTED: LOW QUALITY PROTEIN: light-regulated protein-like [Cucumis sativus] Length = 137 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 232 VDREYLEYEDQKTVFPGEACDDLGGEFCQPEYQKGVY 122 V+REYL+Y+ KTVFP EACDDLGGEFC PEYQKGVY Sbjct: 101 VEREYLQYDSPKTVFPAEACDDLGGEFCDPEYQKGVY 137 >gb|ADN33702.1| cytokinin-repressed protein CR9 [Cucumis melo subsp. melo] Length = 106 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 232 VDREYLEYEDQKTVFPGEACDDLGGEFCQPEYQKGVY 122 V+REYL+Y+ KTVFP EACDDLGGEFC PEYQKGVY Sbjct: 70 VEREYLQYDSPKTVFPAEACDDLGGEFCDPEYQKGVY 106