BLASTX nr result
ID: Coptis23_contig00013332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00013332 (1695 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001765252.1| predicted protein [Physcomitrella patens sub... 44 2e-06 >ref|XP_001765252.1| predicted protein [Physcomitrella patens subsp. patens] gi|162683571|gb|EDQ69980.1| predicted protein [Physcomitrella patens subsp. patens] Length = 934 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 19/34 (55%), Positives = 26/34 (76%) Frame = +2 Query: 530 SRGFGFVTFKNEESVAAAVQQHYVKMVGIKEAVQ 631 SRGFGFVTFK+ SV+AAV+ HY+ + G K ++ Sbjct: 251 SRGFGFVTFKHAASVSAAVEAHYINIYGKKVEIK 284 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +1 Query: 451 LGEFFEENFGSVVDNVVMRSQVGEQEQSR 537 L EFFE N+G V+D VV+ SQ G+ QSR Sbjct: 224 LREFFEVNYGPVLDAVVIGSQAGDHMQSR 252