BLASTX nr result
ID: Coptis23_contig00013301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00013301 (446 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62076.1| hypothetical protein VITISV_015538 [Vitis vinifera] 58 9e-07 emb|CAN76029.1| hypothetical protein VITISV_016069 [Vitis vinifera] 58 9e-07 emb|CAN73567.1| hypothetical protein VITISV_003451 [Vitis vinifera] 55 6e-06 emb|CAN77498.1| hypothetical protein VITISV_042223 [Vitis vinifera] 55 8e-06 >emb|CAN62076.1| hypothetical protein VITISV_015538 [Vitis vinifera] Length = 313 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +1 Query: 1 AIDFVRSKENLADPLTKGLARELVFSTSRGMGLKSIKD 114 ++D+V+SK+N+ADPLTKGL RELV +SRGMGLK IK+ Sbjct: 276 SVDYVKSKDNIADPLTKGLNRELVEKSSRGMGLKPIKE 313 >emb|CAN76029.1| hypothetical protein VITISV_016069 [Vitis vinifera] Length = 1096 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +1 Query: 1 AIDFVRSKENLADPLTKGLARELVFSTSRGMGLKSIKD 114 ++D+V+SK+N+ADPLTKGL RELV +SRGMGLK IK+ Sbjct: 1059 SVDYVKSKDNIADPLTKGLNRELVEKSSRGMGLKPIKE 1096 >emb|CAN73567.1| hypothetical protein VITISV_003451 [Vitis vinifera] Length = 1277 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +1 Query: 1 AIDFVRSKENLADPLTKGLARELVFSTSRGMGLKSIKD 114 ++D+V+SK+N+ADPLTKGL RELV +SRGM LK IK+ Sbjct: 1240 SVDYVKSKDNIADPLTKGLNRELVEKSSRGMXLKPIKE 1277 >emb|CAN77498.1| hypothetical protein VITISV_042223 [Vitis vinifera] Length = 429 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 7 DFVRSKENLADPLTKGLARELVFSTSRGMGLKSIK 111 DFV+SK+N+ADPLTKGL RE V T+RGMGLK IK Sbjct: 395 DFVKSKDNIADPLTKGLYREQVVVTTRGMGLKPIK 429