BLASTX nr result
ID: Coptis23_contig00013103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00013103 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518418.1| 26S protease regulatory subunit, putative [R... 78 8e-13 ref|XP_002331561.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 gb|AAO42237.1| putative vesicle transfer ATPase [Arabidopsis tha... 75 5e-12 ref|NP_192327.3| AAA-type ATPase family protein [Arabidopsis tha... 75 5e-12 gb|AAC28233.1| contains similarity to ATPases associated with va... 75 5e-12 >ref|XP_002518418.1| 26S protease regulatory subunit, putative [Ricinus communis] gi|223542263|gb|EEF43805.1| 26S protease regulatory subunit, putative [Ricinus communis] Length = 587 Score = 77.8 bits (190), Expect = 8e-13 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +1 Query: 250 DQEWCEIEDTILLALHSRKVYDDIARGTWRKFESNRPRAILFEGPSG 390 DQ+ EIEDTILLALHS +VYD+IARGT RKFESNRPRA+LFEGP G Sbjct: 311 DQQKQEIEDTILLALHSPEVYDNIARGTRRKFESNRPRAVLFEGPPG 357 >ref|XP_002331561.1| predicted protein [Populus trichocarpa] gi|222873785|gb|EEF10916.1| predicted protein [Populus trichocarpa] Length = 562 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +1 Query: 250 DQEWCEIEDTILLALHSRKVYDDIARGTWRKFESNRPRAILFEGPSG 390 DQ+ EIEDTILLAL S +VYDDIARGT RKFESNRPRA+LFEGP G Sbjct: 288 DQQKREIEDTILLALQSPEVYDDIARGTRRKFESNRPRAVLFEGPPG 334 >gb|AAO42237.1| putative vesicle transfer ATPase [Arabidopsis thaliana] Length = 180 Score = 75.1 bits (183), Expect = 5e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +1 Query: 250 DQEWCEIEDTILLALHSRKVYDDIARGTWRKFESNRPRAILFEGPSG 390 DQ+ EIEDTIL+ALHS +VYDDI RGT KFESNRPRA+LFEGP G Sbjct: 134 DQQKREIEDTILMALHSPEVYDDIVRGTRSKFESNRPRAVLFEGPPG 180 >ref|NP_192327.3| AAA-type ATPase family protein [Arabidopsis thaliana] gi|332656970|gb|AEE82370.1| AAA-type ATPase family protein [Arabidopsis thaliana] Length = 609 Score = 75.1 bits (183), Expect = 5e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +1 Query: 250 DQEWCEIEDTILLALHSRKVYDDIARGTWRKFESNRPRAILFEGPSG 390 DQ+ EIEDTIL+ALHS +VYDDI RGT KFESNRPRA+LFEGP G Sbjct: 325 DQQKREIEDTILMALHSPEVYDDIVRGTRSKFESNRPRAVLFEGPPG 371 >gb|AAC28233.1| contains similarity to ATPases associated with various cellular activities (Pfam: AAA.hmm, score: 155.05) [Arabidopsis thaliana] gi|7267174|emb|CAB77886.1| putative vesicle transfer ATPase [Arabidopsis thaliana] Length = 536 Score = 75.1 bits (183), Expect = 5e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +1 Query: 250 DQEWCEIEDTILLALHSRKVYDDIARGTWRKFESNRPRAILFEGPSG 390 DQ+ EIEDTIL+ALHS +VYDDI RGT KFESNRPRA+LFEGP G Sbjct: 252 DQQKREIEDTILMALHSPEVYDDIVRGTRSKFESNRPRAVLFEGPPG 298