BLASTX nr result
ID: Coptis23_contig00013025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00013025 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF98467.1| cytochrome P450 [Coptis japonica var. dissecta] 89 4e-16 gb|AGC29952.1| CYP81B57 [Sinopodophyllum hexandrum] 76 2e-12 gb|ABB20892.1| cytochrome P450, partial [Datura metel] 69 4e-10 gb|ADD84651.1| CYP81B36 [Scoparia dulcis] 69 5e-10 emb|CBI36289.3| unnamed protein product [Vitis vinifera] 68 9e-10 >dbj|BAF98467.1| cytochrome P450 [Coptis japonica var. dissecta] Length = 503 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 271 QCFDWERIGEEMVDMSEGPGLTLHKLQPLEAKCRPRSVALKFISQF 134 QCFDWER+GEEMVDMSEGPGLTL K+ PLEAKCRPRS AL FISQF Sbjct: 458 QCFDWERVGEEMVDMSEGPGLTLPKVHPLEAKCRPRSTALNFISQF 503 >gb|AGC29952.1| CYP81B57 [Sinopodophyllum hexandrum] Length = 507 Score = 76.3 bits (186), Expect = 2e-12 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 271 QCFDWERIGEEMVDMSEGPGLTLHKLQPLEAKCRPRSVALKFISQ 137 QCFDW R+GEEMV+MSEG GLTL KL PLEA CRPRS L F+SQ Sbjct: 462 QCFDWHRVGEEMVEMSEGTGLTLPKLHPLEAHCRPRSTMLNFLSQ 506 >gb|ABB20892.1| cytochrome P450, partial [Datura metel] Length = 74 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 271 QCFDWERIGEEMVDMSEGPGLTLHKLQPLEAKCRPRSVALKFISQ 137 QCFDW+RIG+E+VDM+EG GLTL K QPL AKC+PR V +SQ Sbjct: 29 QCFDWQRIGKELVDMTEGTGLTLPKAQPLVAKCKPRPVMANLLSQ 73 >gb|ADD84651.1| CYP81B36 [Scoparia dulcis] Length = 502 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 271 QCFDWERIGEEMVDMSEGPGLTLHKLQPLEAKCRPRSVALKFISQ 137 QCFDWER+G+E+VDMSEG GLTL K QPL A CR R +A K +SQ Sbjct: 457 QCFDWERVGKELVDMSEGVGLTLPKAQPLMAYCRARPLAAKLLSQ 501 >emb|CBI36289.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -1 Query: 271 QCFDWERIGEEMVDMSEGPGLTLHKLQPLEAKCRPRSVALKFISQ 137 QCFDWER+GE VDMSEG GLTL K QPL AKCRPR + +SQ Sbjct: 373 QCFDWERVGEGKVDMSEGIGLTLPKAQPLLAKCRPRPALINVLSQ 417