BLASTX nr result
ID: Coptis23_contig00012428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00012428 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003565991.1| PREDICTED: putative F-box protein At1g50870-... 55 4e-06 >ref|XP_003565991.1| PREDICTED: putative F-box protein At1g50870-like [Brachypodium distachyon] Length = 428 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/60 (45%), Positives = 37/60 (61%) Frame = -1 Query: 204 LLCNELVTEILIRLPPKSIYKSKCICKLWRFLITEPTFIERLKSLPPLTTGFFYNRFSKV 25 LL ++L+ EIL RLP +S+++ KC+CKLWR LI P K LP GF Y+ + V Sbjct: 40 LLTDDLIVEILSRLPARSVHRFKCVCKLWRDLIAYPA---HRKRLPQTLAGFLYSTHTGV 96