BLASTX nr result
ID: Coptis23_contig00012390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00012390 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528892.1| hypothetical protein RCOM_0187400 [Ricinus c... 58 9e-07 >ref|XP_002528892.1| hypothetical protein RCOM_0187400 [Ricinus communis] gi|223531646|gb|EEF33472.1| hypothetical protein RCOM_0187400 [Ricinus communis] Length = 523 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/57 (47%), Positives = 42/57 (73%) Frame = -1 Query: 308 KEDREENVQRMDVIKAAKNALVSDATNMINKFKHMEANALNNSEDFDDEDDYQGSDG 138 KE+ + N+Q++DV+++AKNALVS+A + INK +H++ NA ++S D D D Y DG Sbjct: 462 KENGQINIQKIDVVRSAKNALVSEARDAINKLQHLQTNANDDSSDISD-DGYVNIDG 517