BLASTX nr result
ID: Coptis23_contig00012373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00012373 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis... 69 3e-10 gb|ABC55718.1| beta-mannosidase 1 [Oncidium Gower Ramsey] 69 4e-10 gb|ABC55716.1| beta-mannosidase 3 [Oncidium Gower Ramsey] 69 4e-10 ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis... 69 5e-10 ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis... 69 5e-10 >ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis] gi|223527070|gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis] Length = 517 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 2 KSGYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 112 +SGYTSRFGIVYVD+ LKRYPKMSAYWFK ML RKK Sbjct: 480 RSGYTSRFGIVYVDFTTLKRYPKMSAYWFKQMLQRKK 516 >gb|ABC55718.1| beta-mannosidase 1 [Oncidium Gower Ramsey] Length = 491 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 2 KSGYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 112 KSGYTSRFGIVYVD+K LKRYPKMSAYWF+ +L +KK Sbjct: 455 KSGYTSRFGIVYVDFKTLKRYPKMSAYWFRDVLQKKK 491 >gb|ABC55716.1| beta-mannosidase 3 [Oncidium Gower Ramsey] Length = 491 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 2 KSGYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 112 KSGYTSRFGIVYVD+K LKRYPKMSAYWF+ +L +KK Sbjct: 455 KSGYTSRFGIVYVDFKTLKRYPKMSAYWFRDVLQKKK 491 >ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus] Length = 503 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 8 GYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 112 GYTSRFGIVYVDY +LKRYPKMSAYWFK +L RKK Sbjct: 468 GYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLERKK 502 >ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus] Length = 503 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 8 GYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLARKK 112 GYTSRFGIVYVDY +LKRYPKMSAYWFK +L RKK Sbjct: 468 GYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLERKK 502