BLASTX nr result
ID: Coptis23_contig00012356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00012356 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546241.1| PREDICTED: cysteine desulfurase 2, chloropla... 69 5e-11 ref|XP_002267920.1| PREDICTED: cysteine desulfurase 2, chloropla... 68 1e-10 gb|ACU15091.1| unknown [Glycine max] 67 3e-10 ref|XP_004140178.1| PREDICTED: cysteine desulfurase 2, chloropla... 65 7e-10 gb|AAF22900.1|AC006932_17 T27G7.17 [Arabidopsis thaliana] 65 1e-09 >ref|XP_003546241.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Glycine max] Length = 468 Score = 69.3 bits (168), Expect(2) = 5e-11 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -3 Query: 127 NWCTWIKPTAVLDSLQNYYSTYNSNVHRGIHFLSARAADEYE 2 N T KPTAVL +LQNYY YNSNVHRGIHFLSARA DEYE Sbjct: 83 NAATSQKPTAVLKALQNYYEAYNSNVHRGIHFLSARATDEYE 124 Score = 22.7 bits (47), Expect(2) = 5e-11 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 146 RNVNKSKLVYLDKA 105 + VN SKLVYLD A Sbjct: 71 QEVNGSKLVYLDNA 84 >ref|XP_002267920.1| PREDICTED: cysteine desulfurase 2, chloroplastic [Vitis vinifera] gi|296083920|emb|CBI24308.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 68.2 bits (165), Expect(2) = 1e-10 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -3 Query: 127 NWCTWIKPTAVLDSLQNYYSTYNSNVHRGIHFLSARAADEYE 2 N T KPTAVL +LQNYY YNSNVHRGIHFLSA+A DEYE Sbjct: 78 NAATSQKPTAVLKALQNYYEAYNSNVHRGIHFLSAKATDEYE 119 Score = 22.7 bits (47), Expect(2) = 1e-10 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 146 RNVNKSKLVYLDKA 105 + VN SKLVYLD A Sbjct: 66 QEVNGSKLVYLDNA 79 >gb|ACU15091.1| unknown [Glycine max] Length = 205 Score = 66.6 bits (161), Expect(2) = 3e-10 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -3 Query: 127 NWCTWIKPTAVLDSLQNYYSTYNSNVHRGIHFLSARAADEYE 2 N T KPT VL +LQNYY YNSNVHRGIHFLSA+A DEYE Sbjct: 83 NAATSQKPTTVLKALQNYYEAYNSNVHRGIHFLSAKATDEYE 124 Score = 22.7 bits (47), Expect(2) = 3e-10 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 146 RNVNKSKLVYLDKA 105 + VN SKLVYLD A Sbjct: 71 QEVNGSKLVYLDNA 84 >ref|XP_004140178.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cucumis sativus] gi|449481029|ref|XP_004156061.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cucumis sativus] Length = 485 Score = 65.5 bits (158), Expect(2) = 7e-10 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 127 NWCTWIKPTAVLDSLQNYYSTYNSNVHRGIHFLSARAADEYE 2 N T KP +VL++LQNYY YNSNVHRGIHFLSA+A DEYE Sbjct: 100 NAATSQKPISVLNALQNYYQAYNSNVHRGIHFLSAKATDEYE 141 Score = 22.7 bits (47), Expect(2) = 7e-10 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 146 RNVNKSKLVYLDKA 105 + VN SKLVYLD A Sbjct: 88 QEVNGSKLVYLDNA 101 >gb|AAF22900.1|AC006932_17 T27G7.17 [Arabidopsis thaliana] Length = 526 Score = 64.7 bits (156), Expect(2) = 1e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 109 KPTAVLDSLQNYYSTYNSNVHRGIHFLSARAADEYE 2 KP AVLD+LQNYY YNSNVHRGIH+LSA+A DE+E Sbjct: 84 KPAAVLDALQNYYEFYNSNVHRGIHYLSAKATDEFE 119 Score = 22.7 bits (47), Expect(2) = 1e-09 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 146 RNVNKSKLVYLDKA 105 + VN SKLVYLD A Sbjct: 66 QEVNGSKLVYLDSA 79