BLASTX nr result
ID: Coptis23_contig00012346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00012346 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS80150.1| ACT11D09.4 [Cucumis melo] 100 1e-19 ref|XP_003548343.1| PREDICTED: pentatricopeptide repeat-containi... 99 4e-19 ref|XP_004156778.1| PREDICTED: pentatricopeptide repeat-containi... 98 6e-19 ref|XP_004148094.1| PREDICTED: pentatricopeptide repeat-containi... 98 6e-19 ref|XP_003630728.1| Pentatricopeptide repeat-containing protein ... 96 2e-18 >gb|AAS80150.1| ACT11D09.4 [Cucumis melo] Length = 896 Score = 100 bits (250), Expect = 1e-19 Identities = 49/73 (67%), Positives = 57/73 (78%) Frame = -2 Query: 221 LLDRQFQMTPATCNVLLQTLLRNGKNEEATTLFQTMLDNHKTPNTHAVNSETFNIMVNEY 42 LLDRQF+M PATCNVLL+ LL++ K EA TLF MLDNH PN AVNS+TFNIMVNE Sbjct: 311 LLDRQFKMVPATCNVLLEVLLKHEKKTEAWTLFDQMLDNHTPPNFQAVNSDTFNIMVNEC 370 Query: 41 FRLGKVSEALTVF 3 F+LGK +EA+ F Sbjct: 371 FKLGKFTEAVETF 383 >ref|XP_003548343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10270-like [Glycine max] Length = 861 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/73 (64%), Positives = 56/73 (76%) Frame = -2 Query: 221 LLDRQFQMTPATCNVLLQTLLRNGKNEEATTLFQTMLDNHKTPNTHAVNSETFNIMVNEY 42 LLDRQF+MTPATCNVLL+ LL++ K+ EA +LF MLDNH PN AVNS+TFNIMVN Sbjct: 285 LLDRQFRMTPATCNVLLEVLLKHSKSNEAWSLFHLMLDNHTPPNFQAVNSDTFNIMVNHC 344 Query: 41 FRLGKVSEALTVF 3 F+LG +AL F Sbjct: 345 FKLGNFEDALATF 357 >ref|XP_004156778.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10270-like [Cucumis sativus] Length = 559 Score = 98.2 bits (243), Expect = 6e-19 Identities = 48/73 (65%), Positives = 56/73 (76%) Frame = -2 Query: 221 LLDRQFQMTPATCNVLLQTLLRNGKNEEATTLFQTMLDNHKTPNTHAVNSETFNIMVNEY 42 LLDRQF+M PATCNVLL+ LL++ K EA TLF MLDNH PN AVNS+TFNIMVNE Sbjct: 119 LLDRQFKMVPATCNVLLEVLLKHEKKTEAWTLFDQMLDNHTPPNFQAVNSDTFNIMVNEC 178 Query: 41 FRLGKVSEALTVF 3 F+ GK +EA+ F Sbjct: 179 FKHGKFAEAVETF 191 >ref|XP_004148094.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10270-like [Cucumis sativus] Length = 871 Score = 98.2 bits (243), Expect = 6e-19 Identities = 48/73 (65%), Positives = 56/73 (76%) Frame = -2 Query: 221 LLDRQFQMTPATCNVLLQTLLRNGKNEEATTLFQTMLDNHKTPNTHAVNSETFNIMVNEY 42 LLDRQF+M PATCNVLL+ LL++ K EA TLF MLDNH PN AVNS+TFNIMVNE Sbjct: 285 LLDRQFKMVPATCNVLLEVLLKHEKKTEAWTLFDQMLDNHTPPNFQAVNSDTFNIMVNEC 344 Query: 41 FRLGKVSEALTVF 3 F+ GK +EA+ F Sbjct: 345 FKHGKFAEAVETF 357 >ref|XP_003630728.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524750|gb|AET05204.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 918 Score = 96.3 bits (238), Expect = 2e-18 Identities = 46/72 (63%), Positives = 55/72 (76%) Frame = -2 Query: 218 LDRQFQMTPATCNVLLQTLLRNGKNEEATTLFQTMLDNHKTPNTHAVNSETFNIMVNEYF 39 +DR+F+MTPATCNVLL+ LL++ K +EA LF MLDNH PN AVNS+TFNIMVNE F Sbjct: 286 MDREFRMTPATCNVLLEVLLKHDKKKEAWKLFDQMLDNHTPPNFQAVNSDTFNIMVNECF 345 Query: 38 RLGKVSEALTVF 3 + GK EAL F Sbjct: 346 KHGKFDEALDTF 357