BLASTX nr result
ID: Coptis23_contig00012192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00012192 (692 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269887.1| PREDICTED: subtilisin inhibitor 1 [Vitis vin... 82 6e-15 ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus co... 76 6e-12 ref|XP_003538225.1| PREDICTED: subtilisin inhibitor 1-like [Glyc... 72 8e-11 ref|XP_003598789.1| Subtilisin inhibitor [Medicago truncatula] g... 72 1e-10 ref|XP_003598785.1| CCP [Medicago truncatula] gi|355487833|gb|AE... 70 4e-10 >ref|XP_002269887.1| PREDICTED: subtilisin inhibitor 1 [Vitis vinifera] gi|297740333|emb|CBI30515.3| unnamed protein product [Vitis vinifera] Length = 110 Score = 82.0 bits (201), Expect(2) = 6e-15 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = +2 Query: 305 GTTAEEAENKIKLDMPRANIQVVPPDHFVTMDFNTRRVRLYVDASGKVARPPQVG 469 G T EEAE KI+ DMPR QVVPP+ FVTMDFNTRRVRL+VD+ GKV+R P++G Sbjct: 56 GMTVEEAERKIREDMPRVQFQVVPPNCFVTMDFNTRRVRLHVDSEGKVSRAPRIG 110 Score = 24.6 bits (52), Expect(2) = 6e-15 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +3 Query: 144 MAEENKQTELTEEQP 188 MA+EN++TEL +E+P Sbjct: 1 MADENQRTELPQERP 15 >ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus communis] gi|223527228|gb|EEF29391.1| subtilisin inhibitor 1, putative [Ricinus communis] Length = 103 Score = 76.3 bits (186), Expect = 6e-12 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = +2 Query: 305 GTTAEEAENKIKLDMPRANIQVVPPDHFVTMDFNTRRVRLYVDASGKVARPPQVG 469 G AEEAE KIK DMP +QVV P+ F+TMDF RVRL++D+SGKVARPP++G Sbjct: 49 GVMAEEAERKIKEDMPGVEVQVVQPNCFITMDFREGRVRLFIDSSGKVARPPRIG 103 >ref|XP_003538225.1| PREDICTED: subtilisin inhibitor 1-like [Glycine max] Length = 98 Score = 72.4 bits (176), Expect = 8e-11 Identities = 36/55 (65%), Positives = 40/55 (72%) Frame = +2 Query: 305 GTTAEEAENKIKLDMPRANIQVVPPDHFVTMDFNTRRVRLYVDASGKVARPPQVG 469 G TAEEAE KIK +M A IQVVPP +FVT DF +RVRLYVD S KV R P +G Sbjct: 44 GVTAEEAEKKIKEEMGGAEIQVVPPGYFVTADFKPKRVRLYVDESNKVTRAPGIG 98 >ref|XP_003598789.1| Subtilisin inhibitor [Medicago truncatula] gi|355487837|gb|AES69040.1| Subtilisin inhibitor [Medicago truncatula] Length = 98 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/55 (65%), Positives = 39/55 (70%) Frame = +2 Query: 305 GTTAEEAENKIKLDMPRANIQVVPPDHFVTMDFNTRRVRLYVDASGKVARPPQVG 469 G TAEEAE KIK D+ IQVVPPD FVT DF +RVRLYVD S KV R P +G Sbjct: 44 GVTAEEAERKIKEDISGVEIQVVPPDSFVTADFRFKRVRLYVDESNKVIRTPIIG 98 >ref|XP_003598785.1| CCP [Medicago truncatula] gi|355487833|gb|AES69036.1| CCP [Medicago truncatula] gi|388510874|gb|AFK43503.1| unknown [Medicago truncatula] Length = 94 Score = 70.1 bits (170), Expect = 4e-10 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = +2 Query: 305 GTTAEEAENKIKLDMPRANIQVVPPDHFVTMDFNTRRVRLYVDASGKVARPPQVG 469 G TAEEAE KIK +M I+VVPP +FVT D+NT+RVRLYVD S K+ + P +G Sbjct: 40 GVTAEEAERKIKEEMNGVEIRVVPPGYFVTADYNTQRVRLYVDQSNKLIKTPTIG 94