BLASTX nr result
ID: Coptis23_contig00011857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00011857 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17922.3| unnamed protein product [Vitis vinifera] 86 3e-15 ref|XP_002275124.1| PREDICTED: guanylate-binding protein 4-like ... 86 3e-15 ref|XP_002520972.1| interferon-induced guanylate-binding protein... 84 1e-14 ref|XP_002306811.1| predicted protein [Populus trichocarpa] gi|2... 82 4e-14 ref|XP_004162193.1| PREDICTED: guanylate-binding protein 4-like ... 81 1e-13 >emb|CBI17922.3| unnamed protein product [Vitis vinifera] Length = 602 Score = 85.9 bits (211), Expect = 3e-15 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -1 Query: 140 LSQILEALNKGEIPSTGSLVEVFNKGILERCMKLYSERMGKLGLPL 3 + QILEALNKGEIPSTGSLVEVFNKGILERC+KLYSERMGK+ LPL Sbjct: 306 MEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYSERMGKVALPL 351 >ref|XP_002275124.1| PREDICTED: guanylate-binding protein 4-like [Vitis vinifera] Length = 674 Score = 85.9 bits (211), Expect = 3e-15 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -1 Query: 140 LSQILEALNKGEIPSTGSLVEVFNKGILERCMKLYSERMGKLGLPL 3 + QILEALNKGEIPSTGSLVEVFNKGILERC+KLYSERMGK+ LPL Sbjct: 378 MEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYSERMGKVALPL 423 >ref|XP_002520972.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] gi|223539809|gb|EEF41389.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] Length = 631 Score = 84.0 bits (206), Expect = 1e-14 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = -1 Query: 140 LSQILEALNKGEIPSTGSLVEVFNKGILERCMKLYSERMGKLGLPL 3 L QILEALNKGEIPSTGSLVEVFNKGILERC+KLY E M KLGLPL Sbjct: 335 LEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYGESMAKLGLPL 380 >ref|XP_002306811.1| predicted protein [Populus trichocarpa] gi|222856260|gb|EEE93807.1| predicted protein [Populus trichocarpa] Length = 663 Score = 82.4 bits (202), Expect = 4e-14 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = -1 Query: 140 LSQILEALNKGEIPSTGSLVEVFNKGILERCMKLYSERMGKLGLPL 3 L QILEALNKGEIPSTGSLVEVFNKGILERC+KLYSE M KL LPL Sbjct: 367 LEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYSEMMAKLPLPL 412 >ref|XP_004162193.1| PREDICTED: guanylate-binding protein 4-like [Cucumis sativus] Length = 619 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 140 LSQILEALNKGEIPSTGSLVEVFNKGILERCMKLYSERMGKLGLPL 3 L QILEALNKGEIPSTGSLVEVFNKGILERC+K+YS+RM K+ LP+ Sbjct: 323 LEQILEALNKGEIPSTGSLVEVFNKGILERCLKIYSDRMAKVPLPI 368