BLASTX nr result
ID: Coptis23_contig00010783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00010783 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACZ67202.1| cytochrome P450 allene oxide synthase [Populus ni... 117 7e-25 gb|AFC17171.1| cytochrome P450 allene oxide synthase, partial [P... 115 4e-24 gb|ACZ67201.1| cytochrome P450 allene oxide synthase [Populus de... 115 4e-24 gb|ACZ67200.1| cytochrome P450 allene oxide synthase [Populus ba... 115 4e-24 ref|XP_002326909.1| cytochrome P450 allene oxide synthase [Popul... 115 4e-24 >gb|ACZ67202.1| cytochrome P450 allene oxide synthase [Populus nigra] Length = 227 Score = 117 bits (294), Expect = 7e-25 Identities = 55/66 (83%), Positives = 61/66 (92%) Frame = +2 Query: 2 FVADRFVGEGEELLKYVVWSNGPETENPTVANKQCPGKDFVVLVSRLLLVEFFLRYDSFG 181 FVADRF+GEGEELLK+V+WSNGPETE PT+ NKQC GKDFVVLV+RLL+VEFFLRYDSF Sbjct: 146 FVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVARLLVVEFFLRYDSFE 205 Query: 182 IEVGTS 199 IEVG S Sbjct: 206 IEVGKS 211 >gb|AFC17171.1| cytochrome P450 allene oxide synthase, partial [Populus laurifolia] Length = 210 Score = 115 bits (288), Expect = 4e-24 Identities = 54/66 (81%), Positives = 60/66 (90%) Frame = +2 Query: 2 FVADRFVGEGEELLKYVVWSNGPETENPTVANKQCPGKDFVVLVSRLLLVEFFLRYDSFG 181 FVADRF+GEGEELLK+V+WSNGPETE PT+ NKQC GKDFVVLV+RLL+VE FLRYDSF Sbjct: 129 FVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVARLLVVELFLRYDSFE 188 Query: 182 IEVGTS 199 IEVG S Sbjct: 189 IEVGKS 194 >gb|ACZ67201.1| cytochrome P450 allene oxide synthase [Populus deltoides] Length = 227 Score = 115 bits (288), Expect = 4e-24 Identities = 54/66 (81%), Positives = 60/66 (90%) Frame = +2 Query: 2 FVADRFVGEGEELLKYVVWSNGPETENPTVANKQCPGKDFVVLVSRLLLVEFFLRYDSFG 181 FVADRF+GEGEELLK+V+WSNGPETE PT+ NKQC GKDFVVLV+RLL+VE FLRYDSF Sbjct: 146 FVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVARLLVVELFLRYDSFE 205 Query: 182 IEVGTS 199 IEVG S Sbjct: 206 IEVGKS 211 >gb|ACZ67200.1| cytochrome P450 allene oxide synthase [Populus balsamifera] Length = 227 Score = 115 bits (288), Expect = 4e-24 Identities = 54/66 (81%), Positives = 60/66 (90%) Frame = +2 Query: 2 FVADRFVGEGEELLKYVVWSNGPETENPTVANKQCPGKDFVVLVSRLLLVEFFLRYDSFG 181 FVADRF+GEGEELLK+V+WSNGPETE PT+ NKQC GKDFVVLV+RLL+VE FLRYDSF Sbjct: 146 FVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVARLLVVELFLRYDSFE 205 Query: 182 IEVGTS 199 IEVG S Sbjct: 206 IEVGKS 211 >ref|XP_002326909.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] gi|222835224|gb|EEE73659.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] Length = 445 Score = 115 bits (288), Expect = 4e-24 Identities = 54/66 (81%), Positives = 60/66 (90%) Frame = +2 Query: 2 FVADRFVGEGEELLKYVVWSNGPETENPTVANKQCPGKDFVVLVSRLLLVEFFLRYDSFG 181 FVADRF+GEGEELLK+V+WSNGPETE PT+ NKQC GKDFVVLV+RLL+VE FLRYDSF Sbjct: 364 FVADRFIGEGEELLKHVLWSNGPETEKPTLGNKQCAGKDFVVLVARLLVVELFLRYDSFE 423 Query: 182 IEVGTS 199 IEVG S Sbjct: 424 IEVGKS 429