BLASTX nr result
ID: Coptis23_contig00010346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00010346 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513943.1| conserved hypothetical protein [Ricinus comm... 83 3e-14 ref|XP_002285762.1| PREDICTED: uncharacterized protein LOC100259... 82 6e-14 ref|XP_003544803.1| PREDICTED: uncharacterized protein LOC100791... 80 1e-13 ref|XP_002301062.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 gb|ABK93831.1| unknown [Populus trichocarpa] gi|118487520|gb|ABK... 79 3e-13 >ref|XP_002513943.1| conserved hypothetical protein [Ricinus communis] gi|223547029|gb|EEF48526.1| conserved hypothetical protein [Ricinus communis] Length = 317 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +2 Query: 137 AGRKLDEFVQDPSSLLKYHKGPLLSGKITINLIWYGKFKPSQRAIISDF 283 A RKL+E VQD LL+YH GPLLSGKI+INLIWYGKF+PSQ+AIISDF Sbjct: 24 AARKLNELVQDQPQLLRYHNGPLLSGKISINLIWYGKFQPSQKAIISDF 72 >ref|XP_002285762.1| PREDICTED: uncharacterized protein LOC100259041 [Vitis vinifera] gi|147765766|emb|CAN68978.1| hypothetical protein VITISV_040774 [Vitis vinifera] Length = 319 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +2 Query: 137 AGRKLDEFVQDPSSLLKYHKGPLLSGKITINLIWYGKFKPSQRAIISDF 283 A RKL+E VQ LL+YH GPLLSGKI+INLIWYGKFKPSQRAI+SDF Sbjct: 25 AARKLNELVQQQPLLLEYHNGPLLSGKISINLIWYGKFKPSQRAIVSDF 73 >ref|XP_003544803.1| PREDICTED: uncharacterized protein LOC100791695 [Glycine max] Length = 313 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 137 AGRKLDEFVQDPSSLLKYHKGPLLSGKITINLIWYGKFKPSQRAIISDF 283 A R+L+E VQD + LL+YH GPLLSGKI+INLIWYG FKPSQ+AI+SDF Sbjct: 20 ATRRLNELVQDQTQLLRYHNGPLLSGKISINLIWYGHFKPSQKAIVSDF 68 >ref|XP_002301062.1| predicted protein [Populus trichocarpa] gi|222842788|gb|EEE80335.1| predicted protein [Populus trichocarpa] Length = 319 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = +2 Query: 137 AGRKLDEFVQDPSSLLKYHKGPLLSGKITINLIWYGKFKPSQRAIISDF 283 A RKL+E VQD LL+YH G LL GKI++NLIWYGKFKPSQRAIISDF Sbjct: 24 AARKLNELVQDQPQLLRYHDGALLYGKISVNLIWYGKFKPSQRAIISDF 72 >gb|ABK93831.1| unknown [Populus trichocarpa] gi|118487520|gb|ABK95587.1| unknown [Populus trichocarpa] Length = 319 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = +2 Query: 137 AGRKLDEFVQDPSSLLKYHKGPLLSGKITINLIWYGKFKPSQRAIISDF 283 A RKL+E VQD LL+YH G LL GKI++NLIWYGKFKPSQRAIISDF Sbjct: 24 AARKLNELVQDQPQLLRYHDGALLYGKISVNLIWYGKFKPSQRAIISDF 72