BLASTX nr result
ID: Coptis23_contig00010227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00010227 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517107.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002517107.1| conserved hypothetical protein [Ricinus communis] gi|223543742|gb|EEF45270.1| conserved hypothetical protein [Ricinus communis] Length = 1377 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 7/69 (10%) Frame = +1 Query: 88 EEIRKYNNNTDNEDEE-------KLFSQLKPYCIKLLDLVQNPSKKNAPEISQLHHFLQQ 246 E+ D+E EE +F QLKPYC++LL+LVQNP KK++ I L FLQ Sbjct: 2 EDFNNLTGENDDESEELVQERKGSVFLQLKPYCLELLELVQNP-KKDSSAIPSLLRFLQS 60 Query: 247 TPSHALQPF 273 +PS +LQPF Sbjct: 61 SPSVSLQPF 69