BLASTX nr result
ID: Coptis23_contig00010183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00010183 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30928.3| unnamed protein product [Vitis vinifera] 76 3e-12 ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 isoform 1... 76 3e-12 emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera] 76 3e-12 gb|AEX97082.1| F-box family protein [Malus x domestica] 75 7e-12 ref|XP_003593894.1| F-box family protein [Medicago truncatula] g... 74 2e-11 >emb|CBI30928.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/54 (66%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -3 Query: 161 IWPEPDYTNPNPDVIIDH-DHFDRIPDSLLLIVFNKIEDVKTLGRCCVVSRRFY 3 IWPEP + P ++ + DHFDR+PDSLLL+VFNKI DVK LGRCCVVSRRF+ Sbjct: 45 IWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFH 98 >ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 isoform 1 [Vitis vinifera] gi|359483890|ref|XP_003633032.1| PREDICTED: F-box protein At5g46170 isoform 2 [Vitis vinifera] Length = 399 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/54 (66%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -3 Query: 161 IWPEPDYTNPNPDVIIDH-DHFDRIPDSLLLIVFNKIEDVKTLGRCCVVSRRFY 3 IWPEP + P ++ + DHFDR+PDSLLL+VFNKI DVK LGRCCVVSRRF+ Sbjct: 13 IWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFH 66 >emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera] Length = 399 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/54 (66%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -3 Query: 161 IWPEPDYTNPNPDVIIDH-DHFDRIPDSLLLIVFNKIEDVKTLGRCCVVSRRFY 3 IWPEP + P ++ + DHFDR+PDSLLL+VFNKI DVK LGRCCVVSRRF+ Sbjct: 13 IWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFH 66 >gb|AEX97082.1| F-box family protein [Malus x domestica] Length = 403 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = -3 Query: 167 SSIWPEPDYTNPNPDVIIDHDHFDRIPDSLLLIVFNKIEDVKTLGRCCVVSRRFY 3 S+++PEP Y++ +D DHFDR+PDSLLL+VFNKI DVK LGRCCVVSRRF+ Sbjct: 12 STVYPEP-YSS------VDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFH 59 >ref|XP_003593894.1| F-box family protein [Medicago truncatula] gi|355482942|gb|AES64145.1| F-box family protein [Medicago truncatula] Length = 389 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = -3 Query: 152 EPDYTNPNPDVIIDHDHFDRIPDSLLLIVFNKIEDVKTLGRCCVVSRRFY 3 +P+ P P DHFDRIPDSLLL+VFNKI DVK LGRCCVVSRRF+ Sbjct: 9 QPNRIYPEPSYFPQIDHFDRIPDSLLLLVFNKIGDVKALGRCCVVSRRFH 58