BLASTX nr result
ID: Coptis23_contig00010182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00010182 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271847.2| PREDICTED: cytochrome P450 704C1-like [Vitis... 47 4e-06 emb|CBI31936.3| unnamed protein product [Vitis vinifera] 47 4e-06 ref|XP_002312255.1| cytochrome P450 [Populus trichocarpa] gi|222... 47 6e-06 >ref|XP_002271847.2| PREDICTED: cytochrome P450 704C1-like [Vitis vinifera] Length = 817 Score = 47.0 bits (110), Expect(2) = 4e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 248 EFSTIVFREYALKLSSILNQASADKKEVDMQ 156 +FSTIVFREY+LKLS+IL++AS +EVDMQ Sbjct: 426 DFSTIVFREYSLKLSAILSEASFHNREVDMQ 456 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 39 ELLMRMTLDSICK 1 +LLMRMTLDSICK Sbjct: 457 DLLMRMTLDSICK 469 >emb|CBI31936.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 47.0 bits (110), Expect(2) = 4e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 248 EFSTIVFREYALKLSSILNQASADKKEVDMQ 156 +FSTIVFREY+LKLS+IL++AS +EVDMQ Sbjct: 88 DFSTIVFREYSLKLSAILSEASFHNREVDMQ 118 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 39 ELLMRMTLDSICK 1 +LLMRMTLDSICK Sbjct: 119 DLLMRMTLDSICK 131 >ref|XP_002312255.1| cytochrome P450 [Populus trichocarpa] gi|222852075|gb|EEE89622.1| cytochrome P450 [Populus trichocarpa] Length = 482 Score = 47.0 bits (110), Expect(2) = 6e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 248 EFSTIVFREYALKLSSILNQASADKKEVDMQ 156 +FST+VFREY+LKLSSIL+QAS +EV+MQ Sbjct: 152 DFSTVVFREYSLKLSSILSQASFHNQEVEMQ 182 Score = 27.7 bits (60), Expect(2) = 6e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 36 LLMRMTLDSICK 1 LLMRMTLDSICK Sbjct: 184 LLMRMTLDSICK 195