BLASTX nr result
ID: Coptis23_contig00010162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00010162 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282027.2| PREDICTED: interactor of constitutive active... 61 8e-08 emb|CAN75085.1| hypothetical protein VITISV_024243 [Vitis vinifera] 61 8e-08 ref|XP_002532251.1| ATP binding protein, putative [Ricinus commu... 61 1e-07 ref|XP_002323453.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_003542499.1| PREDICTED: interactor of constitutive active... 58 7e-07 >ref|XP_002282027.2| PREDICTED: interactor of constitutive active ROPs 3-like [Vitis vinifera] Length = 624 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +1 Query: 1 SAGNNAKCMDRSGSLDSNYHPVTGKICSPYSEDMDDDSP 117 SAG+N K +++GSLDSNY+ +TGKI SPYSED+DD+SP Sbjct: 566 SAGSNGKLTEKTGSLDSNYNHITGKITSPYSEDLDDESP 604 >emb|CAN75085.1| hypothetical protein VITISV_024243 [Vitis vinifera] Length = 657 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +1 Query: 1 SAGNNAKCMDRSGSLDSNYHPVTGKICSPYSEDMDDDSP 117 SAG+N K +++GSLDSNY+ +TGKI SPYSED+DD+SP Sbjct: 599 SAGSNGKLTEKTGSLDSNYNHITGKITSPYSEDLDDESP 637 >ref|XP_002532251.1| ATP binding protein, putative [Ricinus communis] gi|223528039|gb|EEF30117.1| ATP binding protein, putative [Ricinus communis] Length = 618 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 1 SAGNNAKCMDRSGSLDSNYHPVTGKICSPYSEDMDDD 111 SAGNN + M+R+GSLDS+Y+P TG+I SPY+EDMDDD Sbjct: 560 SAGNNGRFMERTGSLDSSYNPATGRIGSPYNEDMDDD 596 >ref|XP_002323453.1| predicted protein [Populus trichocarpa] gi|222868083|gb|EEF05214.1| predicted protein [Populus trichocarpa] Length = 609 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +1 Query: 1 SAGNNAKCMDRSGSLDSNYHPVTGKICSPYSEDMDDDSP 117 S GNN K ++R+GSLD+NY+P+ G + SP+SEDMDDDSP Sbjct: 551 STGNNGKFVERTGSLDNNYNPIPGNMGSPFSEDMDDDSP 589 >ref|XP_003542499.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] Length = 624 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +1 Query: 1 SAGNNAKCMDRSGSLDSNYHPVTGKICSPYSEDMDDDSP 117 SAGNN K ++R+GSLDS+Y+ +T K+ SPYSE+ DDDSP Sbjct: 567 SAGNNGKFVERTGSLDSSYNSITAKMSSPYSENTDDDSP 605