BLASTX nr result
ID: Coptis23_contig00009946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00009946 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 62.4 bits (150), Expect = 4e-08 Identities = 35/57 (61%), Positives = 39/57 (68%) Frame = -1 Query: 226 AGLPVPS*ELVNVAKAKAWTLLVLE*RALRQAGFTEQRSPSALSRGRITG*CLMGPS 56 AGLP PS EL V AK T L+LE R LR+AGFTEQRSP AL G ITG C + P+ Sbjct: 9 AGLPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWITGSCHLIPA 65 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/57 (50%), Positives = 35/57 (61%) Frame = -3 Query: 224 WLARSKLRAGQCG*GESLDLVSPRVKGTASGWLHRAAFTFRSQPWEDYRLVPHGSLQ 54 WLARSKLR CG GE + PR +GTA GW HRAA T S W+D V G+++ Sbjct: 3 WLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLPGAIE 59