BLASTX nr result
ID: Coptis23_contig00009765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00009765 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607979.1| ATP-dependent DNA helicase PIF1 [Medicago tr... 41 2e-07 >ref|XP_003607979.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula] gi|355509034|gb|AES90176.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula] Length = 432 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -2 Query: 76 KNSGVFFVDGPGGT*KTYLYRAILA 2 K+S VFFVDGP GT KT+LYRA++A Sbjct: 49 KHSQVFFVDGPDGTGKTFLYRALMA 73 Score = 39.3 bits (90), Expect(2) = 2e-07 Identities = 17/40 (42%), Positives = 27/40 (67%) Frame = -1 Query: 200 FSELLQNELSVVVPHEDLLSIDHLNQEQLSAYRAILQVIE 81 F ++Q ELSV +P+ED+ SI LN +Q+ A+ I+ I+ Sbjct: 6 FQGVIQEELSVQIPNEDIESIQMLNHDQMVAFNTIMHAID 45