BLASTX nr result
ID: Coptis23_contig00009688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00009688 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus ... 61 8e-08 ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millet... 61 8e-08 dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [N... 61 8e-08 ref|YP_003587235.1| ribosomal protein S4 [Citrullus lanatus] gi|... 61 8e-08 ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica ... 61 8e-08 >ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] gi|357197350|gb|AET62946.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 347 KIELPTHYLEANYRTLKAVVFYAPNIAHIPQSKVLQEM 234 +IELPTHYLE NYRTLKAVVFY PNI HIP L+++ Sbjct: 307 RIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDL 344 >ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|372450274|ref|YP_005090457.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197313|gb|AET62910.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197320|gb|AET62917.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 347 KIELPTHYLEANYRTLKAVVFYAPNIAHIPQSKVLQEM 234 +IELPTHYLE NYRTLKAVVFY PNI HIP L+++ Sbjct: 307 RIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDL 344 >dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [Nicotiana tabacum] Length = 349 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 347 KIELPTHYLEANYRTLKAVVFYAPNIAHIPQSKVLQEM 234 +IELPTHYLE NYRTLKAVVFY PNI HIP L+++ Sbjct: 298 RIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDL 335 >ref|YP_003587235.1| ribosomal protein S4 [Citrullus lanatus] gi|259156791|gb|ACV96653.1| ribosomal protein S4 [Citrullus lanatus] Length = 355 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 347 KIELPTHYLEANYRTLKAVVFYAPNIAHIPQSKVLQEM 234 +IELPTHYLE NYRTLKAVVFY PNI HIP L+++ Sbjct: 304 RIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDL 341 >ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica Group] gi|92700092|dbj|BAC19883.2| Ribosomal protein S4 [Oryza sativa Japonica Group] Length = 352 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 347 KIELPTHYLEANYRTLKAVVFYAPNIAHIPQSKVLQEM 234 +IELPTHYLE NYRTLKAVVFY PNI HIP L+++ Sbjct: 301 RIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDL 338