BLASTX nr result
ID: Coptis23_contig00009687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00009687 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus ... 68 9e-10 ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millet... 68 9e-10 ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|375911... 67 2e-09 sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitoc... 67 2e-09 gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] 67 2e-09 >ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] gi|357197350|gb|AET62946.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -3 Query: 339 RRRIKKIELPTHYLEANYRTMKAVVFYAPNIAHIPQSKALQ 217 +RRIK+IELPTHYLE NYRT+KAVVFY PNI HIP L+ Sbjct: 302 KRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLK 342 >ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|372450274|ref|YP_005090457.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197313|gb|AET62910.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197320|gb|AET62917.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -3 Query: 339 RRRIKKIELPTHYLEANYRTMKAVVFYAPNIAHIPQSKALQ 217 +RRIK+IELPTHYLE NYRT+KAVVFY PNI HIP L+ Sbjct: 302 KRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLK 342 >ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|37591124|dbj|BAC98926.1| ribosomal protein S4 [Brassica napus] Length = 362 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 351 KNSRRRRIKKIELPTHYLEANYRTMKAVVFYAPNIAHIPQSKALQ 217 K + +RRIK+IELPTHYLE NYRT KAVVFY PNI HIP L+ Sbjct: 302 KLTMKRRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLK 346 >sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitochondrial Length = 362 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 351 KNSRRRRIKKIELPTHYLEANYRTMKAVVFYAPNIAHIPQSKALQ 217 K + +RRIK+IELPTHYLE NYRT KAVVFY PNI HIP L+ Sbjct: 302 KLTMKRRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLK 346 >gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] Length = 362 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 351 KNSRRRRIKKIELPTHYLEANYRTMKAVVFYAPNIAHIPQSKALQ 217 K + +RRIK+IELPTHYLE NYRT KAVVFY PNI HIP L+ Sbjct: 302 KLTMKRRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLK 346