BLASTX nr result
ID: Coptis23_contig00009415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00009415 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518586.1| pentatricopeptide repeat-containing protein,... 66 3e-09 ref|XP_002268636.2| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 emb|CBI41008.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002304977.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_003635182.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 >ref|XP_002518586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542431|gb|EEF43973.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 377 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/54 (57%), Positives = 43/54 (79%) Frame = +3 Query: 150 VENFKKFSEIRRFRSRHLLYEKTINRLALAKQHSLVEQVLEHQKKFDDITKEGF 311 VE FKKFSE RFR++ +YE+TI RLA+AK+ + +E++LE QKK+ DI KEG+ Sbjct: 42 VEKFKKFSENDRFRTKTGIYEETIRRLAIAKRFNWIEEILEDQKKYKDIHKEGY 95 >ref|XP_002268636.2| PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial [Vitis vinifera] Length = 383 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/54 (51%), Positives = 42/54 (77%) Frame = +3 Query: 150 VENFKKFSEIRRFRSRHLLYEKTINRLALAKQHSLVEQVLEHQKKFDDITKEGF 311 V+ FKK SE+ RFR++ +YE+T+ RLA AK+ +E++LE QKK+ DI++EGF Sbjct: 43 VQKFKKSSELDRFRTKTGIYEETVRRLASAKRFRWIEEILEEQKKYKDISREGF 96 >emb|CBI41008.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/54 (51%), Positives = 42/54 (77%) Frame = +3 Query: 150 VENFKKFSEIRRFRSRHLLYEKTINRLALAKQHSLVEQVLEHQKKFDDITKEGF 311 V+ FKK SE+ RFR++ +YE+T+ RLA AK+ +E++LE QKK+ DI++EGF Sbjct: 51 VQKFKKSSELDRFRTKTGIYEETVRRLASAKRFRWIEEILEEQKKYKDISREGF 104 >ref|XP_002304977.1| predicted protein [Populus trichocarpa] gi|222847941|gb|EEE85488.1| predicted protein [Populus trichocarpa] Length = 381 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = +3 Query: 150 VENFKKFSEIRRFRSRHLLYEKTINRLALAKQHSLVEQVLEHQKKFDDITKEGF 311 VE FKK SE RFR++ +Y+ TI RLA AK+ VE++LE+QK++ D++KEGF Sbjct: 43 VEKFKKASENERFRTKSAIYKDTIRRLAAAKKFRYVEEILENQKQYQDMSKEGF 96 >ref|XP_003635182.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Vitis vinifera] Length = 382 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/54 (51%), Positives = 42/54 (77%) Frame = +3 Query: 150 VENFKKFSEIRRFRSRHLLYEKTINRLALAKQHSLVEQVLEHQKKFDDITKEGF 311 V+ FKK SE+ RFR++ +YE+T+ RLA AK+ +E++LE QKK+ DI++EGF Sbjct: 43 VQKFKKSSELDRFRTKTGIYEETVRRLASAKRFRWIEEILEEQKKYKDISREGF 96