BLASTX nr result
ID: Coptis23_contig00009356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00009356 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597735.1| Pentatricopeptide repeat-containing protein ... 57 2e-06 ref|XP_003532686.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_003597735.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240430|gb|ABD32288.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355486783|gb|AES67986.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 620 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 1 SIVIEREILVRDVNRYHRFMHGSCTCGDHW 90 S ++EREI VRDVNRYH F HG C+CGDHW Sbjct: 591 SKIMEREITVRDVNRYHSFKHGMCSCGDHW 620 >ref|XP_003532686.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 561 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +1 Query: 7 VIEREILVRDVNRYHRFMHGSCTCGDHW 90 VIEREI+VRDVNRYHRF++G+CTC D W Sbjct: 534 VIEREIIVRDVNRYHRFVNGNCTCSDIW 561