BLASTX nr result
ID: Coptis23_contig00009203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00009203 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531995.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 >ref|XP_002531995.1| conserved hypothetical protein [Ricinus communis] gi|223528354|gb|EEF30394.1| conserved hypothetical protein [Ricinus communis] Length = 374 Score = 66.6 bits (161), Expect = 2e-09 Identities = 40/104 (38%), Positives = 52/104 (50%), Gaps = 10/104 (9%) Frame = +2 Query: 23 SVLGEYFDDISWKLKDGGW-SDXXXXXXXXXXXXXKRRVVCLKDKDS---------VAWH 172 S LG+ +D+ WKL+DGGW + KR C D D V WH Sbjct: 249 SSLGDCLEDVFWKLRDGGWREEDVREMMMIDGCDEKRENGCGGDGDGGRVQNGKLDVVWH 308 Query: 173 VKFLSLSLLRAGWSKEDVVYSFGFEDGVVPDVNSSLDVQDSNSN 304 V+ LS+ LLRAGWS+EDVVYS +D + D LD N++ Sbjct: 309 VRVLSVVLLRAGWSREDVVYSLDLQD--LEDSKCCLDFPPPNTS 350