BLASTX nr result
ID: Coptis23_contig00009000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00009000 (1474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548264.1| PREDICTED: arginine/serine-rich-splicing fac... 68 2e-16 ref|XP_003528779.1| PREDICTED: arginine/serine-rich-splicing fac... 65 1e-14 gb|ACU23171.1| unknown [Glycine max] 65 1e-14 ref|XP_002302651.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-13 ref|XP_002320882.1| predicted protein [Populus trichocarpa] gi|2... 65 4e-13 >ref|XP_003548264.1| PREDICTED: arginine/serine-rich-splicing factor RSP31-like [Glycine max] Length = 264 Score = 67.8 bits (164), Expect(2) = 2e-16 Identities = 36/56 (64%), Positives = 39/56 (69%), Gaps = 8/56 (14%) Frame = +3 Query: 720 NFSKVLGRVVSVEYALRDDGERGDRHESPRRGYEGRGDSPY--------GRSRSPV 863 N SK+L RVVSVEYALRDDGERGD ++SPRRG R SPY GR RSPV Sbjct: 146 NMSKILDRVVSVEYALRDDGERGDNYDSPRRGGYERSPSPYHRRPSPDYGRPRSPV 201 Score = 45.4 bits (106), Expect(2) = 2e-16 Identities = 20/34 (58%), Positives = 22/34 (64%) Frame = +2 Query: 980 DYGRARSPDYGRGRSPVYDKYNGPSYNGGKSSEY 1081 DYGR RSPDYGR RSP Y + P Y +S EY Sbjct: 217 DYGRHRSPDYGRRRSPDYGRRKSPDYGKPRSPEY 250 >ref|XP_003528779.1| PREDICTED: arginine/serine-rich-splicing factor RSP31-like [Glycine max] Length = 259 Score = 65.5 bits (158), Expect(2) = 1e-14 Identities = 38/58 (65%), Positives = 41/58 (70%), Gaps = 10/58 (17%) Frame = +3 Query: 720 NFSKVLGRVVSVEYALRDDGERGDRHESPRR--GYEGRGDSPY--------GRSRSPV 863 N SK+L RVVSVEYALRDDGERGD ++SPRR GYE R SPY GR RSPV Sbjct: 146 NMSKILDRVVSVEYALRDDGERGDNYDSPRRRGGYE-RSPSPYHRRPSPDYGRPRSPV 202 Score = 41.6 bits (96), Expect(2) = 1e-14 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 980 DYGRARSPDYGRGRSPVYDKYNGPSYNGGKS 1072 DYGR RSPDYGR RSP Y K P Y +S Sbjct: 218 DYGRHRSPDYGRRRSPDYGKPRSPEYGRYRS 248 >gb|ACU23171.1| unknown [Glycine max] Length = 259 Score = 65.5 bits (158), Expect(2) = 1e-14 Identities = 38/58 (65%), Positives = 41/58 (70%), Gaps = 10/58 (17%) Frame = +3 Query: 720 NFSKVLGRVVSVEYALRDDGERGDRHESPRR--GYEGRGDSPY--------GRSRSPV 863 N SK+L RVVSVEYALRDDGERGD ++SPRR GYE R SPY GR RSPV Sbjct: 146 NMSKILDRVVSVEYALRDDGERGDNYDSPRRRGGYE-RSPSPYHRRPSPDYGRPRSPV 202 Score = 41.6 bits (96), Expect(2) = 1e-14 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 980 DYGRARSPDYGRGRSPVYDKYNGPSYNGGKS 1072 DYGR RSPDYGR RSP Y K P Y +S Sbjct: 218 DYGRHRSPDYGRRRSPDYGKPRSPEYGRYRS 248 >ref|XP_002302651.1| predicted protein [Populus trichocarpa] gi|222844377|gb|EEE81924.1| predicted protein [Populus trichocarpa] Length = 236 Score = 64.3 bits (155), Expect(2) = 2e-13 Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 10/58 (17%) Frame = +3 Query: 720 NFSKVLGRVVSVEYALRDDGERGDRHESPRRG-YEGRGDSP---------YGRSRSPV 863 + +K+L RVVSVEYALRDD ERGDR++SPRRG Y GR SP Y R+RSPV Sbjct: 149 HMTKILDRVVSVEYALRDDSERGDRYDSPRRGSYNGRSPSPVYRRRPSPDYVRARSPV 206 Score = 39.3 bits (90), Expect(2) = 2e-13 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +2 Query: 980 DYGRARSPDYGRGRSPVYDKYNGPSYNGGKSSEY 1081 DY RARSP Y + PVYD+ P Y +S EY Sbjct: 198 DYVRARSPVYDKYNGPVYDRRQSPDYGRNRSPEY 231 >ref|XP_002320882.1| predicted protein [Populus trichocarpa] gi|222861655|gb|EEE99197.1| predicted protein [Populus trichocarpa] Length = 236 Score = 64.7 bits (156), Expect(2) = 4e-13 Identities = 35/58 (60%), Positives = 40/58 (68%), Gaps = 10/58 (17%) Frame = +3 Query: 720 NFSKVLGRVVSVEYALRDDGERGDRHESPRRG-YEGRGDSP---------YGRSRSPV 863 + +K+L RVVSVEYALRDD ERGDR++SPRRG Y GR SP YGR SPV Sbjct: 150 HMTKILDRVVSVEYALRDDSERGDRYDSPRRGSYYGRSPSPAHHRRPNPDYGRGHSPV 207 Score = 37.4 bits (85), Expect(2) = 4e-13 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 980 DYGRARSPDYGRGRSPVYDKYNGPSYNGGKSSEY 1081 DYGR SP Y + PV+D+ P Y +S EY Sbjct: 199 DYGRGHSPVYDKYNGPVHDRRRSPDYGRNRSPEY 232