BLASTX nr result
ID: Coptis23_contig00008697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00008697 (522 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003572452.1| PREDICTED: cytochrome c-type biogenesis prot... 77 2e-12 dbj|BAJ86584.1| predicted protein [Hordeum vulgare subsp. vulgare] 77 2e-12 ref|XP_002451946.1| hypothetical protein SORBIDRAFT_04g010410 [S... 76 3e-12 ref|XP_002516012.1| Cytochrome c-type biogenesis protein cycL pr... 75 4e-12 ref|NP_001169212.1| uncharacterized protein LOC100383068 [Zea ma... 75 7e-12 >ref|XP_003572452.1| PREDICTED: cytochrome c-type biogenesis protein CcmH-like [Brachypodium distachyon] Length = 151 Score = 76.6 bits (187), Expect = 2e-12 Identities = 39/61 (63%), Positives = 45/61 (73%) Frame = -3 Query: 520 SPVLXXXXXXXXXAYQKHRQKTNVHIMALNLVRGVPLTPKEKQVMLEILTXXXPQGGRRW 341 SPV+ AYQKHRQ+TNVHIMALNLVRGVPLTP+EK+ M++ILT P RRW Sbjct: 90 SPVIVGGVAAGMWAYQKHRQRTNVHIMALNLVRGVPLTPREKETMIDILTPPPP--ARRW 147 Query: 340 W 338 W Sbjct: 148 W 148 >dbj|BAJ86584.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 152 Score = 76.6 bits (187), Expect = 2e-12 Identities = 39/61 (63%), Positives = 45/61 (73%) Frame = -3 Query: 520 SPVLXXXXXXXXXAYQKHRQKTNVHIMALNLVRGVPLTPKEKQVMLEILTXXXPQGGRRW 341 SPV+ AYQKHRQ+TNVHIMALNLVRGVPLTP+EK+ M++ILT P RRW Sbjct: 90 SPVIVGGVAAGVWAYQKHRQRTNVHIMALNLVRGVPLTPREKETMIDILTPPPP--ARRW 147 Query: 340 W 338 W Sbjct: 148 W 148 >ref|XP_002451946.1| hypothetical protein SORBIDRAFT_04g010410 [Sorghum bicolor] gi|241931777|gb|EES04922.1| hypothetical protein SORBIDRAFT_04g010410 [Sorghum bicolor] Length = 152 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/61 (63%), Positives = 45/61 (73%) Frame = -3 Query: 520 SPVLXXXXXXXXXAYQKHRQKTNVHIMALNLVRGVPLTPKEKQVMLEILTXXXPQGGRRW 341 SPV+ AYQKHRQ+TNVHIMALNLVRGVPLTP+EK+ ML+ILT P R+W Sbjct: 90 SPVIVGGIAAGIWAYQKHRQRTNVHIMALNLVRGVPLTPREKETMLDILTPPPPP--RKW 147 Query: 340 W 338 W Sbjct: 148 W 148 >ref|XP_002516012.1| Cytochrome c-type biogenesis protein cycL precursor, putative [Ricinus communis] gi|223544917|gb|EEF46432.1| Cytochrome c-type biogenesis protein cycL precursor, putative [Ricinus communis] Length = 159 Score = 75.5 bits (184), Expect = 4e-12 Identities = 39/63 (61%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -3 Query: 520 SPVLXXXXXXXXXAYQKHRQKTNVHIMALNLVRGVPLTPKEKQVMLEILTXXXPQGG--R 347 SP+L AY KHRQKTNVHIMALNLVRGVPLTPKEK+ ML+ILT +G Sbjct: 92 SPLLVAGAAGGIWAYNKHRQKTNVHIMALNLVRGVPLTPKEKETMLDILTPPTTKGATPS 151 Query: 346 RWW 338 WW Sbjct: 152 SWW 154 >ref|NP_001169212.1| uncharacterized protein LOC100383068 [Zea mays] gi|195613152|gb|ACG28406.1| cytochrome c-type biogenesis protein cycL precursor [Zea mays] gi|223975477|gb|ACN31926.1| unknown [Zea mays] gi|223975557|gb|ACN31966.1| unknown [Zea mays] gi|413936370|gb|AFW70921.1| cytochrome c-type biogenesis protein cycL isoform 1 [Zea mays] gi|413936371|gb|AFW70922.1| cytochrome c-type biogenesis protein cycL isoform 2 [Zea mays] Length = 152 Score = 74.7 bits (182), Expect = 7e-12 Identities = 38/61 (62%), Positives = 45/61 (73%) Frame = -3 Query: 520 SPVLXXXXXXXXXAYQKHRQKTNVHIMALNLVRGVPLTPKEKQVMLEILTXXXPQGGRRW 341 SPV+ AYQ+HRQ+TNVHIMALNLVRGVPLTP+EK+ ML+ILT P R+W Sbjct: 90 SPVIVGGIAAGIWAYQRHRQRTNVHIMALNLVRGVPLTPREKETMLDILT--PPPAPRKW 147 Query: 340 W 338 W Sbjct: 148 W 148