BLASTX nr result
ID: Coptis23_contig00008670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00008670 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531984.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_002311149.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002881659.1| hypothetical protein ARALYDRAFT_903200 [Arab... 69 5e-10 ref|XP_002879803.1| hypothetical protein ARALYDRAFT_903202 [Arab... 69 5e-10 ref|NP_565907.1| uncharacterized protein [Arabidopsis thaliana] ... 68 9e-10 >ref|XP_002531984.1| conserved hypothetical protein [Ricinus communis] gi|223528381|gb|EEF30420.1| conserved hypothetical protein [Ricinus communis] Length = 91 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +3 Query: 66 FWCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEED 179 FW ASFLI WAA LQGHMMWL+RQDSFK KFGTL + D Sbjct: 12 FWFASFLIGWAAALQGHMMWLQRQDSFKQKFGTLNQND 49 >ref|XP_002311149.1| predicted protein [Populus trichocarpa] gi|222850969|gb|EEE88516.1| predicted protein [Populus trichocarpa] Length = 59 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 69 WCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEED 179 W ASFLIAWAA LQGHMMWL+RQDSFK KFGTL E++ Sbjct: 17 WFASFLIAWAAALQGHMMWLRRQDSFKQKFGTLNEDN 53 >ref|XP_002881659.1| hypothetical protein ARALYDRAFT_903200 [Arabidopsis lyrata subsp. lyrata] gi|297327498|gb|EFH57918.1| hypothetical protein ARALYDRAFT_903200 [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 68.6 bits (166), Expect = 5e-10 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 66 FWCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEED 179 FW ASFLI WAA LQGHMMWL++Q+SFK KFGT++E+D Sbjct: 14 FWVASFLIVWAAGLQGHMMWLQKQESFKQKFGTIDEDD 51 >ref|XP_002879803.1| hypothetical protein ARALYDRAFT_903202 [Arabidopsis lyrata subsp. lyrata] gi|297325642|gb|EFH56062.1| hypothetical protein ARALYDRAFT_903202 [Arabidopsis lyrata subsp. lyrata] Length = 55 Score = 68.6 bits (166), Expect = 5e-10 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 66 FWCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEED 179 FW ASFLI WAA LQGHMMWL++Q+SFK KFGT++E+D Sbjct: 16 FWVASFLIVWAAGLQGHMMWLQKQESFKQKFGTIDEDD 53 >ref|NP_565907.1| uncharacterized protein [Arabidopsis thaliana] gi|3355479|gb|AAC27841.1| expressed protein [Arabidopsis thaliana] gi|14335016|gb|AAK59772.1| At2g39500/F12L6.16 [Arabidopsis thaliana] gi|330254593|gb|AEC09687.1| uncharacterized protein [Arabidopsis thaliana] Length = 55 Score = 67.8 bits (164), Expect = 9e-10 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +3 Query: 66 FWCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEED 179 FW ASF+I WAA LQGHMMWL++Q+SFK KFGT++E+D Sbjct: 16 FWIASFIIVWAAGLQGHMMWLQKQESFKQKFGTIDEDD 53