BLASTX nr result
ID: Coptis23_contig00008633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00008633 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6,... 126 2e-27 emb|CBI20465.3| unnamed protein product [Vitis vinifera] 125 4e-27 ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthe... 125 4e-27 ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthe... 125 4e-27 ref|XP_004149936.1| PREDICTED: indole-3-acetic acid-amido synthe... 125 5e-27 >ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] gi|223526345|gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 126 bits (316), Expect = 2e-27 Identities = 57/66 (86%), Positives = 61/66 (92%) Frame = -1 Query: 345 IKIVESGSFDKLMDYAISRGASMNQYKTPRCVKFEPIVELLNSKVVSSYFSPKCPNWIPG 166 IKIVE G+FDKLMDYAIS GAS+NQYKTPRCVKF PIVELLNS+VVSSYFSPKCP W+PG Sbjct: 545 IKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPG 604 Query: 165 HKQWHN 148 HKQW N Sbjct: 605 HKQWGN 610 >emb|CBI20465.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 125 bits (314), Expect = 4e-27 Identities = 56/66 (84%), Positives = 62/66 (93%) Frame = -1 Query: 345 IKIVESGSFDKLMDYAISRGASMNQYKTPRCVKFEPIVELLNSKVVSSYFSPKCPNWIPG 166 +KIVESG+FDKLMDYAIS GAS+NQYKTPRCVKF PI+ELLNS+VVS+YFSPKCP WIPG Sbjct: 502 MKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPG 561 Query: 165 HKQWHN 148 HKQW N Sbjct: 562 HKQWCN 567 >ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 2 [Vitis vinifera] Length = 596 Score = 125 bits (314), Expect = 4e-27 Identities = 56/66 (84%), Positives = 62/66 (93%) Frame = -1 Query: 345 IKIVESGSFDKLMDYAISRGASMNQYKTPRCVKFEPIVELLNSKVVSSYFSPKCPNWIPG 166 +KIVESG+FDKLMDYAIS GAS+NQYKTPRCVKF PI+ELLNS+VVS+YFSPKCP WIPG Sbjct: 529 MKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPG 588 Query: 165 HKQWHN 148 HKQW N Sbjct: 589 HKQWCN 594 >ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 1 [Vitis vinifera] gi|147866579|emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] Length = 613 Score = 125 bits (314), Expect = 4e-27 Identities = 56/66 (84%), Positives = 62/66 (93%) Frame = -1 Query: 345 IKIVESGSFDKLMDYAISRGASMNQYKTPRCVKFEPIVELLNSKVVSSYFSPKCPNWIPG 166 +KIVESG+FDKLMDYAIS GAS+NQYKTPRCVKF PI+ELLNS+VVS+YFSPKCP WIPG Sbjct: 546 MKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPG 605 Query: 165 HKQWHN 148 HKQW N Sbjct: 606 HKQWCN 611 >ref|XP_004149936.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis sativus] gi|449516764|ref|XP_004165416.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis sativus] Length = 604 Score = 125 bits (313), Expect = 5e-27 Identities = 54/64 (84%), Positives = 61/64 (95%) Frame = -1 Query: 345 IKIVESGSFDKLMDYAISRGASMNQYKTPRCVKFEPIVELLNSKVVSSYFSPKCPNWIPG 166 IK+VE+G+FDKLMDYAIS GAS+NQYKTPRCVKF+PIVELLNS+VV SYFSPKCP W+PG Sbjct: 537 IKVVENGTFDKLMDYAISMGASINQYKTPRCVKFQPIVELLNSRVVGSYFSPKCPKWVPG 596 Query: 165 HKQW 154 HKQW Sbjct: 597 HKQW 600