BLASTX nr result
ID: Coptis23_contig00008494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00008494 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358637.1| hypothetical protein PhapfoPp091 [Phalaenopsis ... 176 2e-42 emb|CAN82657.1| hypothetical protein VITISV_042745 [Vitis vinifera] 153 2e-35 ref|XP_003616487.1| Metallocarboxypeptidase inhibitor [Medicago ... 150 1e-34 ref|YP_001152220.1| ORF107c [Pinus koraiensis] gi|145048845|gb|A... 133 1e-29 ref|YP_001312259.1| hypothetical protein CYtaCp094 [Cycas taitun... 130 1e-28 >ref|YP_358637.1| hypothetical protein PhapfoPp091 [Phalaenopsis aphrodite subsp. formosana] gi|58802853|gb|AAW82573.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 131 Score = 176 bits (446), Expect = 2e-42 Identities = 84/90 (93%), Positives = 86/90 (95%) Frame = +2 Query: 53 AVRMPQLHTSLHFHLTPIVMINGSSRRDLLLDSQNFCRSIPAGAENPSLSRLCYRRL*GS 232 +VRMPQLHTSLHFHLTPIVMINGSSRRDL+LDSQ FCRSIP GAENP LSRLCYRRL GS Sbjct: 24 SVRMPQLHTSLHFHLTPIVMINGSSRRDLILDSQYFCRSIPTGAENPPLSRLCYRRLWGS 83 Query: 233 RNRRALILGWAYYLDAFSSYPLRTWLPSVY 322 RNRRALILGWAYYLDAFSSYPLRTWLPSVY Sbjct: 84 RNRRALILGWAYYLDAFSSYPLRTWLPSVY 113 >emb|CAN82657.1| hypothetical protein VITISV_042745 [Vitis vinifera] Length = 120 Score = 153 bits (386), Expect = 2e-35 Identities = 77/90 (85%), Positives = 79/90 (87%) Frame = +2 Query: 53 AVRMPQLHTSLHFHLTPIVMINGSSRRDLLLDSQNFCRSIPAGAENPSLSRLCYRRL*GS 232 +VRMPQLHTSLHFHLTPIVMINGSSRRDLLL+SQNFCRSIPAGAENPSLSRL Sbjct: 24 SVRMPQLHTSLHFHLTPIVMINGSSRRDLLLNSQNFCRSIPAGAENPSLSRL-------- 75 Query: 233 RNRRALILGWAYYLDAFSSYPLRTWLPSVY 322 RALILGWAYYLDAFSSYPLRTWLPSVY Sbjct: 76 ---RALILGWAYYLDAFSSYPLRTWLPSVY 102 >ref|XP_003616487.1| Metallocarboxypeptidase inhibitor [Medicago truncatula] gi|355517822|gb|AES99445.1| Metallocarboxypeptidase inhibitor [Medicago truncatula] Length = 448 Score = 150 bits (378), Expect = 1e-34 Identities = 75/90 (83%), Positives = 79/90 (87%) Frame = +2 Query: 53 AVRMPQLHTSLHFHLTPIVMINGSSRRDLLLDSQNFCRSIPAGAENPSLSRLCYRRL*GS 232 +VRMPQLHT LHFHLTPIVM NGSSRRDLLL+SQN SIPAGA+NP L + YR L GS Sbjct: 33 SVRMPQLHTLLHFHLTPIVMKNGSSRRDLLLNSQNLFCSIPAGAKNPLLFCMRYRSLWGS 92 Query: 233 RNRRALILGWAYYLDAFSSYPLRTWLPSVY 322 RNRRALILGWAYYLDAFSSYPLRTWLPSVY Sbjct: 93 RNRRALILGWAYYLDAFSSYPLRTWLPSVY 122 >ref|YP_001152220.1| ORF107c [Pinus koraiensis] gi|145048845|gb|ABP35461.1| ORF107c [Pinus koraiensis] Length = 107 Score = 133 bits (335), Expect = 1e-29 Identities = 67/89 (75%), Positives = 72/89 (80%), Gaps = 2/89 (2%) Frame = +2 Query: 62 MPQLHTSLHFHLTPIVMINGSSRRDLLLDSQNFCRSIPAGAENPSLSRLCY--RRL*GSR 235 MPQLHTSLHFHLTPIVMINGSSRRDL+LDSQ FCRSIP P + + R GS+ Sbjct: 1 MPQLHTSLHFHLTPIVMINGSSRRDLILDSQYFCRSIPCKDREPVVVPAVFATRGFQGSK 60 Query: 236 NRRALILGWAYYLDAFSSYPLRTWLPSVY 322 NRRALILGWA+YL AFSSYPLRTWLPSVY Sbjct: 61 NRRALILGWAFYLYAFSSYPLRTWLPSVY 89 >ref|YP_001312259.1| hypothetical protein CYtaCp094 [Cycas taitungensis] gi|150251547|ref|YP_001312279.1| hypothetical protein CYtaCp114 [Cycas taitungensis] gi|452848924|ref|YP_007474602.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|452849011|ref|YP_007474690.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|149941577|dbj|BAF65001.1| hypothetical protein (chloroplast) [Cycas taitungensis] gi|149941597|dbj|BAF65021.1| hypothetical protein (chloroplast) [Cycas taitungensis] gi|372863079|gb|AEX99152.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|372863166|gb|AEX99239.1| hypothetical_protein (chloroplast) [Cycas revoluta] Length = 107 Score = 130 bits (327), Expect = 1e-28 Identities = 66/89 (74%), Positives = 70/89 (78%), Gaps = 2/89 (2%) Frame = +2 Query: 62 MPQLHTSLHFHLTPIVMINGSSRRDLLLDSQNFCRSIPAGAENPSLSRLCY--RRL*GSR 235 MPQLH SLHFHLTPIVMINGSSRRDL+LDSQ FCRSIP P + + R GS+ Sbjct: 1 MPQLHASLHFHLTPIVMINGSSRRDLILDSQYFCRSIPCKDRGPVVVSAVFATRGSRGSK 60 Query: 236 NRRALILGWAYYLDAFSSYPLRTWLPSVY 322 NRRALI GWA YLDAFSSYPLRTWLPSVY Sbjct: 61 NRRALISGWASYLDAFSSYPLRTWLPSVY 89