BLASTX nr result
ID: Coptis23_contig00008295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00008295 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516040.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002516040.1| conserved hypothetical protein [Ricinus communis] gi|223544945|gb|EEF46460.1| conserved hypothetical protein [Ricinus communis] Length = 318 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = -2 Query: 133 SVRFIGIALFAFCFIFDSLVSLVDAYNSKDQVGFALQLEIIAIA 2 S+ +IGI +F+F FI DSL+SL +A +SKD +G+ALQL+++AIA Sbjct: 48 SLIYIGITVFSFLFIIDSLISLFNAIDSKDTIGYALQLQVLAIA 91