BLASTX nr result
ID: Coptis23_contig00008212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00008212 (506 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera] 55 5e-06 >emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera] Length = 1813 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/53 (45%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 349 RLNGINFKTWSRSVVHYLTSKGVEGLVDGTYARPAVTDEK-KYTQWKKHNSMV 504 +LNG+N+++WS++V+H LT+K G VDGT P+ DE + QW + NSM+ Sbjct: 319 KLNGVNYQSWSKAVIHALTTKKKIGFVDGTVEEPSQEDEPFMFEQWNQCNSMI 371