BLASTX nr result
ID: Coptis23_contig00008133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00008133 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P46819.2|RPOC1_SINAL RecName: Full=DNA-directed RNA polymeras... 97 2e-18 ref|YP_005090169.1| rpoC1 gene product (chloroplast) [Ricinus co... 93 2e-17 gb|AAZ03989.1| RNA polymerase beta' chain [Typha latifolia] 92 4e-17 gb|AFB18557.1| RNA polymerase beta' subunit [Kingia australis] 92 4e-17 gb|AEZ01418.1| RNA polymerase beta (chloroplast) [Japonolirion o... 92 4e-17 >sp|P46819.2|RPOC1_SINAL RecName: Full=DNA-directed RNA polymerase subunit beta'; AltName: Full=PEP; AltName: Full=Plastid-encoded RNA polymerase subunit beta'; Short=RNA polymerase subunit beta' gi|5457428|emb|CAB48413.1| RNA polymerase A beta prime subunit [Sinapis alba] Length = 688 Score = 96.7 bits (239), Expect = 2e-18 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +1 Query: 1 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDLNSDFT 150 GYIKL CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV FD N +F+ Sbjct: 105 GYIKLTCPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDVCFDRNPNFS 154 >ref|YP_005090169.1| rpoC1 gene product (chloroplast) [Ricinus communis] gi|339516156|gb|AEJ82546.1| RNA polymerase beta subunit [Ricinus communis] Length = 654 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/56 (78%), Positives = 47/56 (83%) Frame = +1 Query: 1 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDLNSDFTGSE*ET 168 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV + + FT +T Sbjct: 105 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDVKYSIPLFFTAQGFDT 160 >gb|AAZ03989.1| RNA polymerase beta' chain [Typha latifolia] Length = 684 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +1 Query: 1 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDLN 138 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV D + Sbjct: 105 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDVYLDFS 150 >gb|AFB18557.1| RNA polymerase beta' subunit [Kingia australis] Length = 683 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +1 Query: 1 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDLN 138 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV D + Sbjct: 105 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDVYLDFS 150 >gb|AEZ01418.1| RNA polymerase beta (chloroplast) [Japonolirion osense] Length = 686 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +1 Query: 1 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDLN 138 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV D + Sbjct: 105 GYIKLACPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDVYLDFS 150