BLASTX nr result
ID: Coptis23_contig00007859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00007859 (870 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528212.1| PREDICTED: zinc finger Ran-binding domain-co... 56 9e-06 >ref|XP_003528212.1| PREDICTED: zinc finger Ran-binding domain-containing protein 3-like [Glycine max] Length = 1193 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 4/65 (6%) Frame = -3 Query: 865 ISCHKEVTAAQAAERRVTRINAKKRLKGILCGLSNGRK----IETINSSLMVDDVDELLV 698 ++CH +VTAAQ AERR+ + NA+K+LK ++ + NG K T MV+ DELLV Sbjct: 1124 VACHYDVTAAQCAERRIAKANARKQLKALMNSMKNGIKGATGTNTKEEGSMVE--DELLV 1181 Query: 697 KVPGT 683 +VPG+ Sbjct: 1182 EVPGS 1186