BLASTX nr result
ID: Coptis23_contig00007591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00007591 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527094.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002527094.1| conserved hypothetical protein [Ricinus communis] gi|223533517|gb|EEF35257.1| conserved hypothetical protein [Ricinus communis] Length = 269 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/73 (34%), Positives = 44/73 (60%) Frame = -2 Query: 409 SPTITQEQKGTRESQPTMAQGPSKWSDYLAEDEDYLLFGTTGSLDDAQAPFNHNMFETNF 230 S T + K R QPT+A SKW+ Y+ D++ + + + D P +H+++E+ Sbjct: 196 SDCTTGKYKEQRTVQPTLATKASKWNAYITHDDNDMGVRSGINFPDDMGPCSHHVWESIS 255 Query: 229 NDQRVEDEVHPDF 191 +DQ+V+D++HPDF Sbjct: 256 DDQKVKDDIHPDF 268