BLASTX nr result
ID: Coptis23_contig00007551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00007551 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002883343.1| predicted protein [Arabidopsis lyrata subsp.... 74 1e-11 >ref|XP_002883343.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297329183|gb|EFH59602.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 85 Score = 73.9 bits (180), Expect = 1e-11 Identities = 40/65 (61%), Positives = 46/65 (70%) Frame = +2 Query: 56 PATKGYMP*AGHLNPGGKAFPQSMRTSRAIGMIILMLRSLALIVVQRQRAASKSASPPST 235 P TK M HL PGG FPQS R+SRA+G I MLRSL+L+VV RQ AAS+S+ PP T Sbjct: 15 PITKEIMR---HLKPGGGVFPQSRRSSRAMGRIRSMLRSLSLMVVHRQTAASRSSKPPKT 71 Query: 236 GQHVS 250 GQH S Sbjct: 72 GQHSS 76