BLASTX nr result
ID: Coptis23_contig00007473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00007473 (753 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA87073.1| pathogenesis-related protein PR-6 type [Sambucus... 84 4e-14 ref|XP_003617314.1| protease inhibitor [Medicago truncatula] gi|... 74 3e-11 pdb|3RDY|A Chain A, Crystal Structure Of Buckwheat Trypsin Inhib... 73 7e-11 gb|AAB35320.1| BWI-1=protease inhibitor/trypsin inhibitor [Fagop... 73 7e-11 gb|AAB46906.1| BTI-2=trypsin inhibitor isoform [Fagopyrum escule... 73 7e-11 >emb|CAA87073.1| pathogenesis-related protein PR-6 type [Sambucus nigra] Length = 79 Score = 83.6 bits (205), Expect = 4e-14 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = +1 Query: 370 SECGGVGKKAWPELLGVREQRAVQTIETENRNVRAVIIPQGSVITPDIRCDRVRVFVHQ- 546 S C VGK WPEL G R + A T+ETEN +V AVI+P+GS++T D RCDRVRV+V + Sbjct: 10 SHCRDVGKNTWPELCGARGEEAAATVETENPSVTAVIVPEGSIVTTDERCDRVRVWVDEN 69 Query: 547 GRVIEVPVVG 576 G V VPV+G Sbjct: 70 GIVTRVPVIG 79 >ref|XP_003617314.1| protease inhibitor [Medicago truncatula] gi|355518649|gb|AET00273.1| protease inhibitor [Medicago truncatula] Length = 70 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 1/72 (1%) Frame = +1 Query: 364 MASECGGVGKKAWPELLGVREQRAVQTIETENRNVRAVIIPQGSVITPDIRCDRVRVFVH 543 M+ EC G K +WPEL+GV + A TI++EN V A+I+P+GS +T D RCDRVRV+V Sbjct: 1 MSDECKG--KNSWPELVGVEGKVAEATIQSENPLVNAIIVPEGSFVTADFRCDRVRVWVD 58 Query: 544 Q-GRVIEVPVVG 576 + G V +VP++G Sbjct: 59 KDGIVYQVPIIG 70 >pdb|3RDY|A Chain A, Crystal Structure Of Buckwheat Trypsin Inhibitor Rbti At 1.84 Angstrom Resolution gi|339717625|pdb|3RDZ|C Chain C, Crystal Structure Of Rbti-Trypsin Complex At 2.26 Angstrom Resolution gi|339717627|pdb|3RDZ|D Chain D, Crystal Structure Of Rbti-Trypsin Complex At 2.26 Angstrom Resolution Length = 79 Score = 72.8 bits (177), Expect = 7e-11 Identities = 33/63 (52%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = +1 Query: 388 GKKAWPELLGVREQRAVQTIETENRNVRAVIIPQGSVITPDIRCDRVRVFV-HQGRVIEV 564 GK+ WPEL+G R +A + IE EN +VRA+++P+GS + D+RCDRV VFV +G V++ Sbjct: 16 GKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDT 75 Query: 565 PVV 573 PVV Sbjct: 76 PVV 78 >gb|AAB35320.1| BWI-1=protease inhibitor/trypsin inhibitor [Fagopyrum esculentum=buckwheat plants, cv. Shatilovskaya-5, seeds, Peptide, 69 aa] gi|109138554|gb|AAP84344.2| proteinase inhibitor [Fagopyrum esculentum] Length = 69 Score = 72.8 bits (177), Expect = 7e-11 Identities = 33/63 (52%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = +1 Query: 388 GKKAWPELLGVREQRAVQTIETENRNVRAVIIPQGSVITPDIRCDRVRVFV-HQGRVIEV 564 GK+ WPEL+G R +A + IE EN +VRA+++P+GS + D+RCDRV VFV +G V++ Sbjct: 6 GKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDT 65 Query: 565 PVV 573 PVV Sbjct: 66 PVV 68 >gb|AAB46906.1| BTI-2=trypsin inhibitor isoform [Fagopyrum esculentum=buckwheat, Monch, seeds, Peptide, 69 aa] Length = 69 Score = 72.8 bits (177), Expect = 7e-11 Identities = 33/63 (52%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = +1 Query: 388 GKKAWPELLGVREQRAVQTIETENRNVRAVIIPQGSVITPDIRCDRVRVFV-HQGRVIEV 564 GK+ WPEL+G R +A + IE EN +VRA+++P+GS + D+RCDRV VFV +G V++ Sbjct: 6 GKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDT 65 Query: 565 PVV 573 PVV Sbjct: 66 PVV 68